KEGG   Podospora anserina: PODANSg1411
Entry
PODANSg1411       CDS       T01048                                 
Name
(RefSeq) hypothetical protein
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
pan  Podospora anserina
Pathway
pan00910  Nitrogen metabolism
pan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PODANSg1411
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pan00199]
    PODANSg1411
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     PODANSg1411
Cytochrome P450 [BR:pan00199]
 Cytochrome P450, fungi type
  CYP55 family
   PODANSg1411
SSDB
Motif
Pfam: p450 YqzE
Other DBs
NCBI-GeneID: 6188514
NCBI-ProteinID: XP_001904391
UniProt: B2AFF2
LinkDB
Position
5
AA seq 435 aa
MTAILTQTPRLSQPPFRTTTLHFLKRSLATMGAVDMPGFPFKRASGLDPPAEFAKLRKTD
PVSKVKLFDGSPAWLVTKYKDVCQVATDQRLSKERRRPGFPELNANGKLAAKQRPTFVDM
DPPEHTKYRGMVEFAFTTEHIDSLKPYITKTVTDLLDKMKSKGCSSGPMDLVQEFALPVP
SYMIYTILGVPFEDLEFLTQQNAIRTNGSSTAREASGAAQELLKYLTQLVEKRLESPKDD
LVSRLVTEQVKTGNLSKEDAVQMAFLLLVAGNATMVNMIALGVVTLFQNPDQLAELKADP
EKWAGPFVEELCRYHTASAMAMKRTAKEDVEIGGKIIRAGEGIIASNQSANRDEDIFSDP
ERFDMHRKWGQECALGFGFGPHRCIGEHLAKAELMTVFATLFDRVPSLKLAKPIDEIEYT
PLDRDVGIVKLPVSW
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgaccgccatcctcacccaaacgccccgtctctcccagccaccattccgaaccaccacc
ctccactttctcaaacgcagtttagccaccatgggagcggtcgatatgcccggtttcccc
tttaaaagggcctccggacttgatcctccagctgagtttgccaagctgaggaagacggat
ccggtgtcgaaggtgaagctgtttgatgggtcaccggcgtggctggtgacaaagtacaag
gatgtttgccaggtggctactgatcagcggctgtcaaaggaaagaagacgccctggcttc
ccggagctgaatgccaatgggaagctcgctgcgaagcagagacctacctttgtggatatg
gatcccccggagcataccaagtatcgtggcatggtcgaattcgccttcacgacagagcac
atcgactctttgaagccctacatcaccaagacagtcacggatttgcttgacaagatgaag
agcaaggggtgctcctctggcccgatggatctggttcaggagttcgctttgcctgtccca
tcttacatgatctacaccatcctcggagtcccttttgaagacctcgagtttttgacccaa
caaaatgccatccgcacaaacggtagctcaacggccagagaagcatctggtgccgcacaa
gagctcctcaagtacctcacccaactcgttgagaagcgtcttgagtcccctaaagatgac
ctcgtcagcaggctagtgacagagcaagtcaagactgggaatctgagcaaggaagatgcg
gtgcaaatggcgtttttgctgcttgttgctgggaatgctacgatggtgaacatgattgct
ttgggcgtggtaaccctcttccagaaccctgaccagcttgctgagctcaaggccgaccca
gagaagtgggcgggtccgtttgttgaggagctgtgccggtaccatactgcgtctgccatg
gcaatgaagaggactgctaaggaggatgtggagattggtggcaagatcatccgcgccgga
gagggcatcatcgcctcgaaccaatcagccaacagagacgaagacattttctcggacccg
gaaagattcgacatgcaccgcaagtggggccaggaatgtgccctcgggtttgggtttggc
ccacaccggtgtatcggggagcatctggcaaaagctgagctgatgactgtgtttgccacg
ctgtttgatagggttccgagcttgaagctggcgaagccaatcgacgagattgagtacacg
cccttggatcgggacgtggggattgtgaagttgcccgtgagttggtag

DBGET integrated database retrieval system