KEGG   Podospora anserina: PODANSg8553
Entry
PODANSg8553       CDS       T01048                                 
Name
(RefSeq) hypothetical protein
  KO
K24856  NADPH-dependent reductase
Organism
pan  Podospora anserina
Pathway
pan00254  Aflatoxin biosynthesis
pan01100  Metabolic pathways
pan01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pan00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PODANSg8553
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-GeneID: 6195883
NCBI-ProteinID: XP_001911511
UniProt: B2B6B1
LinkDB
Position
2
AA seq 280 aa
MTETTPTTTPSSPPSSPKDPFRLDGKVALVTGSGRGIGAGIALALAHRGAKLIINYAHSS
APAEALVSEIKALGPGSDAIAIKADVSDVDQITALMSQAVAHFGKLDIVASNSGVVSFGH
LKDVTPEEFDRVFGVNTRGQFFVAREAYRHLEVGGRIIMTSSNTASVKGVPKHAVYSGSK
GAVETFVRCLAIDCGDKKITVNAVAPGAIKTDMYAAVAREYIPGGENFTDEQVDECAAWL
SPLQRVGLPDDVARAVCFLASDAAEWVNGKIIGIDGGAFR
NT seq 843 nt   +upstreamnt  +downstreamnt
atgacggaaaccaccccaaccaccaccccctcctccccaccatcatcaccaaaagacccc
ttccgcctcgacggcaaagtagccctagtaaccggctccggccgcggcataggcgcagga
atagccctcgccctcgcccaccgcggcgcaaagctcatcatcaactacgcgcactcatcc
gcgccagccgaagccctcgtctccgaaatcaaagccctcggccccggctccgacgccatc
gccatcaaagccgacgtctctgacgtggaccaaatcacggcgctcatgtcccaggccgtc
gcccattttggcaagctcgacatcgtcgcctccaacagcggtgttgtgtcctttggtcat
ttgaaggatgtcacccctgaggagtttgacagggtttttggcgtgaacacgagggggcag
ttttttgttgcgagggaggcgtatagacatttggaggtggggggacggattataatgact
agctcgaatacggcgagtgtgaagggggtgccgaagcatgctgtttatagtggttctaag
ggggcggtggagacttttgtgaggtgtttggccatcgactgcggagacaaaaagatcacc
gtcaatgctgtcgcgcctggggcgatcaagacggacatgtatgctgctgtggctcgcgag
tacatccctggtggggagaactttaccgacgagcaggttgatgagtgtgcagcttggcta
tcgccccttcagcgggtgggactgcctgacgatgttgcccgcgcggtgtgctttctagcc
tcggacgctgccgaatgggtcaatggcaagatcatcggcattgatggtggtgcgtttagg
taa

DBGET integrated database retrieval system