KEGG   Papio anubis (olive baboon): 100997418
Entry
100997418         CDS       T07474                                 
Name
(RefSeq) cytochrome P450 3A5
  KO
K17690  cytochrome P450 family 3 subfamily A5 [EC:1.14.14.1]
Organism
panu  Papio anubis (olive baboon)
Pathway
panu00140  Steroid hormone biosynthesis
panu00830  Retinol metabolism
panu00980  Metabolism of xenobiotics by cytochrome P450
panu00982  Drug metabolism - cytochrome P450
panu01100  Metabolic pathways
panu05204  Chemical carcinogenesis - DNA adducts
Brite
KEGG Orthology (KO) [BR:panu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100997418
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100997418
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100997418
   00982 Drug metabolism - cytochrome P450
    100997418
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    100997418
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:panu00199]
    100997418
Enzymes [BR:panu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100997418
Cytochrome P450 [BR:panu00199]
 Cytochrome P450, animal type
  CYP3 family
   100997418
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100997418
NCBI-ProteinID: XP_021790869
Ensembl: ENSPANG00000023122
VGNC: 81856
LinkDB
Position
4:140355737..140381506
AA seq 505 aa
MAMDLIPNLAMETWLLLAVSLVLLYLYGTRSYGLFKRQGIPGPTPLPFLGNVLSYRQGLW
KFDTECYKKYGKMWRTQDGQLPVLTITDPDMIKTVLVKECYSVFTNRRPFGPVGLMKSAI
NIAENEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGA
YSMDVITSTSFGVNIDSLNNPKDPFVESVKKFLKFDFLDPLFLLTILFPFLIPAFEALNV
SLFPKDAINFLNKSVNSMKKSRLNDKQKHRVDFLQLMIDSQNSKETESHKALSDQELAAQ
SIIFIFAGYETTSSVLSFIIYELATHPDVQQKLQEEIDAVLPNKAPATYDAMVQMEYLDM
VVNETLRLFPIAIRLERACKKDVEINGVFIPKGAMVVIPTYALHHDPKYWTEPEEFRPER
FSKKNKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLAIIKVLQNFSFKPCKETQIPLKLG
NQGLLQSEKPIVLKVESRDGTLSGE
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggcgatggacctcatcccaaatttggccatggaaacctggcttctcctggctgtcagc
ctggtgctcctctatctatacgggacccgttcatatggactttttaagagacagggaatt
ccagggcccacacctctgccttttttgggaaatgttttgtcctatcgtcagggtctctgg
aaatttgacacagaatgttataaaaagtatggaaaaatgtggagaacgcaagatggtcaa
ctccctgtgctgaccatcacagatcccgacatgatcaaaacagtgctagtgaaagaatgt
tattctgtcttcacaaatcgaaggccttttggtccagtgggacttatgaaaagtgccatc
aatatagctgagaatgaagaatggaagagaatacggtcattgctgtctccaaccttcacc
agcggaaaactcaaggagatgttccccatcattgcccagtatggagatgtgttggtgaga
aacttgaggcgggaagcagagaaaggcaagcctgtcaccctgaaagacatctttggggcc
tacagcatggatgtgatcactagcacatcatttggagtgaacatcgactctctcaacaat
ccaaaagacccctttgtggaaagcgttaagaagtttctaaaatttgatttcttagatcca
ttatttctcttaacaatactctttccattccttatcccagcttttgaggcattaaatgtc
tctctgtttccaaaagatgccataaattttttaaataaatctgtaaacagcatgaaaaaa
agtcgcctcaacgacaaacaaaagcaccgagtggatttccttcagctgatgattgactct
cagaattcaaaagaaactgagtcccacaaagctctgtctgatcaggagctcgcggcccaa
tcaattatcttcatttttgctggctatgaaaccaccagcagtgttctttccttcattata
tatgaactggccactcaccctgatgtccagcagaaactgcaggaggagattgatgcagtt
ttgcccaataaggcacctgccacctacgatgccatggtacagatggagtaccttgacatg
gtggtgaatgaaacactcagattattcccaattgctattagacttgagagggcctgcaag
aaagatgttgaaatcaatggggtgttcattcccaaaggggcaatggtggtgattccaacc
tatgctcttcaccatgacccaaagtactggacagagcctgaggagttccgccctgaaagg
ttcagtaagaagaacaaggacagcatagatccttacatatacacaccctttggaactgga
cccagaaactgcattggcatgaggtttgctctcatgaacatgaaacttgctataatcaaa
gtccttcagaacttctccttcaaaccttgtaaagaaacacagatccccttgaaattaggc
aaccaaggccttcttcaatcagaaaaacccattgttctaaaggttgagtcaagagatgga
accctaagtggagaatga

DBGET integrated database retrieval system