KEGG   Papio anubis (olive baboon): 100999935
Entry
100999935         CDS       T07474                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X isoform X1
  KO
K06462  integrin alpha X
Organism
panu  Papio anubis (olive baboon)
Pathway
panu04610  Complement and coagulation cascades
panu04810  Regulation of actin cytoskeleton
panu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:panu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100999935 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100999935 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100999935 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:panu04515]
    100999935 (ITGAX)
   04090 CD molecules [BR:panu04090]
    100999935 (ITGAX)
Cell adhesion molecules [BR:panu04515]
 Integrins
  Integrin alpha subunits
   100999935 (ITGAX)
CD molecules [BR:panu04090]
 Proteins
  100999935 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE FG-GAP_2
Other DBs
NCBI-GeneID: 100999935
NCBI-ProteinID: XP_009194580
Ensembl: ENSPANG00000025500
LinkDB
Position
18:complement(45103889..45139484)
AA seq 1154 aa
MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQERTAA
NQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLAATTSPPQLLACGPTVHHGCGRNM
YLTGLCFLLAPTQLTRRLPASGQECPRQELDIVFLIDGSGSISSDNFATMMNFVRAVINQ
FQRPSTQFSLMQFSSKFDIHFTFEKFRRTSNPLDLLASVHQLTGFTHTATAIQKVVRELF
QASRGARGDATKILIVITDGRKEGDSLDYKDVIPMADAAGIIRYAIGVGSAFQNRNSWKE
LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPILGAVGSFTWSGGAFLYPPNMNPTFINMSQENVDMRDSYLGYSTELALWKGVQNL
VLGAPRYQHTGKTAIFTQVSGQWRLKAEVTGTQIGSYFGASLCSVDVDGDGSTDLILIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLHGEQGHPWGRFGAALTVLGDVNGDKLTDVV
IGAPGEEENQGAVYLFHGALGPSIGPSHSQRIAGSQLSPRLQYFGQALSGGQDLTQDGLV
DLAVGARGQALLLRTRPVLWVRVSMQFKPAEIPRSAFECQEQMVSDQILGQSNICLYIDK
RSKNLLGSRDLQSSLTVDLALDPGRLSPRATFQETKNRSLSRVQVLGLETYCETFTLVLP
TCVEDSVTPITLRLNFTLVGEPLPAFRNLRPMLAADAQRYFMASLPFEKNCGADHICQDN
LGISFSFPGLKTLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRHVAKGQKQGQ
LRSLRLTCDSAPAGSQGTWTTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
SSENNTPRTNKTTFQLALPLKYAVYTVASSHEQSTKYLNFSDSEEKESRVAMHRYQVNNL
GQRDLPVSINFWVPVELNQEAVWMEVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVL
DCSIAGCLRFRCDIPSFSIQEELDFTLKGNLSFGWVRQTSQKKVSVVSVAEITFDTSVYS
QLPGQEAFMRAQTTTVLEKYEIHNPTPLIVGSSIGGLLLLALITAALYKVGFFKRQYKQM
MEEANGQIAPENGT
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgaccaggaccagggcagcgctcctcctgttcacagccttagcaacttctctgggtttc
aacttggacacagaggagctgacagccttccgtgtggacagcgctgggtttggagacagc
gtggtccagtatgccaactcctgggtggtggttggagccccgcaagagagaacagctgcc
aaccaaacgggcggcctctaccagtgcggctacagcaccggtgcctgtgagcccattggc
ctgcaggtccccccggaggccgtgaacatgtccctgggcctgtccctggcggctaccacc
agccccccccagctgctggcctgcggccccaccgtgcaccacgggtgtgggaggaacatg
tacctgaccggactctgcttcctcctggcccccacccagctcacccggaggctcccggcg
tccgggcaggagtgcccaagacaggagctggacattgtgttcctgattgatggctcgggc
agcatctcctccgacaactttgccacgatgatgaacttcgtgagagctgtgataaaccag
ttccagagacccagcacccagttttccctgatgcagttctccagtaaattcgacatacac
ttcactttcgagaaattcaggcgcacctcaaaccccctcgacctgttggcttctgttcac
cagctgacagggttcacacacacggccactgccatccaaaaagtcgtgcgcgaattgttc
caggcctcacgtggggcccgtggggatgccaccaaaattctcattgtcatcactgatggg
aggaaagaaggcgacagcctggattataaggatgtcatccccatggctgatgcagcaggc
atcatccgctatgcaattggggttggatcagcttttcaaaacagaaactcttggaaagaa
ttaaatgacattgcatcgaagccctcccaggaacacatatttaaagtggaggactttgat
gctctgaaagatattcaaaaccagctgaaggagaagatctttgccattgaaggtacggag
accacaagcagcagctccttcgaattggagatggcgcaggagggcttcagcgctgtgttc
acgcctgatggccccattctgggggctgtggggagcttcacctggtctggaggtgccttc
ctgtaccccccaaatatgaaccccaccttcatcaacatgtctcaggagaatgtggacatg
agggactcttacctgggttactccaccgagctggctctctggaaaggggtgcagaacctg
gtcctgggggccccccgctaccagcacaccgggaagactgccatcttcacccaggtgtcc
gggcaatggaggctgaaggccgaagtcacggggacgcagattggttcctacttcggggcc
tccctctgctctgtggatgtggatggcgatggcagcactgacctgatcctcattggggcc
ccccattactacgagcagacccgagggggccaggtgtccgtgtgtcccttgcccaggggg
tggagaaggtggtggtgtgatgctgttctccacggggagcagggccacccctggggtcgc
tttggggcggctctgacagtgctgggggatgtgaatggggacaagctgacggacgtggtc
atcggggccccaggagaggaagagaaccagggtgctgtctacctgtttcacggagccttg
ggacctagcatcggcccctcccacagccagcggatcgccggctcccagctctcccccagg
ctgcagtattttgggcaggcgctgagcgggggtcaagacctcacccaggatggactggtg
gacctagctgtgggagcccgaggccaggcgctcctgctcaggacgagacctgtgctctgg
gtgcgggtgagcatgcagttcaaacctgcggagatccccaggtctgcatttgagtgtcag
gagcagatggtctctgaccagatcctgggacagtccaacatctgcctttacattgacaaa
cgttccaagaacctgcttggcagccgtgacctccaaagctctctgaccgtggacctggct
ctcgaccctggccgcctgagtccccgtgccaccttccaggaaacgaagaaccggagtctg
agccgagtccaagtcctcgggctggagacatactgtgaaaccttcaccctggtgctcccg
acctgcgtggaggactctgtgacccccatcaccttgcgtctgaacttcacgctggtgggt
gagcccctccctgccttcagaaacctgcggcctatgctggccgccgatgctcagagatac
ttcatggcctccctcccctttgagaagaactgtggagccgaccatatctgccaggacaat
ctcggcatctccttcagcttcccaggcctgaagacgctgctggtggggagtaacctggag
ctgaacgcagaagtgatggtgtggaatgacggggaagactcctacggaaccaccatcacc
ttctcccacccggcaggactgtcctaccgccacgtggcaaagggccagaaacaggggcag
ctgcgttccctgcgcctgacatgtgacagcgccccagctggaagccagggcacctggact
accagctgcagaatcaaccacctcatcttccgtggtggcgcccagatcaccttcttggct
acctttgacgtctcccccaaggctgtcctgggagaccggctgcttctgacagccaatgtg
agcagtgagaacaacacccccaggacgaacaagaccaccttccagctggcgctcccgctg
aagtatgccgtctacactgtggctagcagccacgaacaatccaccaagtacctcaacttc
tcagactctgaggagaaggagagccgtgtggccatgcacagataccaggttaataacctg
ggacagagggacctgcctgtcagcatcaacttctgggtgcctgtggagctgaaccaggag
gctgtgtggatggaggtggaggtctcccacccccagaacccatccctgcggtgctcctca
gagaaaattgcacccccagcgtctgacttcctggcacacattcagaagaatcccgtgctg
gactgctccattgctggctgcctgcggttccgctgtgacatcccctccttcagcatccag
gaggagctggatttcaccctgaagggcaacctcagttttggctgggtccgccagacatcg
cagaagaaggtgtcggttgtgagtgtggctgaaattacgttcgacacatccgtgtactcc
cagcttccaggacaggaggcatttatgagagctcagacgacaacggtgctggaaaagtac
gagatccacaaccccacccccctcatcgtaggcagctccattgggggtctgctgctgctg
gcgctcatcacagcagcactgtacaaagttggcttcttcaagcgtcagtacaagcaaatg
atggaggaggcaaatggacaaattgctccagaaaacgggacatag

DBGET integrated database retrieval system