KEGG   Papio anubis (olive baboon): 101007048
Entry
101007048         CDS       T07474                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein isoform X1
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
panu  Papio anubis (olive baboon)
Pathway
panu04927  Cortisol synthesis and secretion
panu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:panu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    101007048 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101007048 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 101007048
NCBI-ProteinID: XP_003895585
Ensembl: ENSPANG00000011261
UniProt: A0A096NR76
LinkDB
Position
4:167886307..167909736
AA seq 172 aa
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVLLLFLILLYM
SWSGSPQMKNSPKHHQTCPWSHSLSLQLCIQKCLPCHREPLGTSRAQASSVEPGSRTDPD
QLLRQESSSTLPLGVFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaacgcctctgccccatactacagctatgaatactacctggactat
ctggacctcattcccgtagacgagaagaagctgaaagcccacaaacattccatcgtgatc
gccttctgggtgagcctggctgccttcgtgctgctcctcttcctcatcctgctttacatg
tcctggtcgggctccccgcagatgaagaacagccccaagcaccaccaaacatgcccctgg
agtcacagcctcagcctccagctctgcatccagaagtgcctgccgtgccacagggaaccc
ctggggacctcacgggctcaggcgagttcagtggagccagggagcagaactgaccctgac
cagctgctacgacaggagagctcctccaccttgccccttggggttttccagacccacccc
actctcctctgggaactgaccctcaatgggggtcccctcgtcagaagcaagcccagcgag
cctccccctggagacaggacctctcaattgcagagctga

DBGET integrated database retrieval system