KEGG   Parasaccharibacter sp. TMW 2.1888: DTQ13_05210
Entry
DTQ13_05210       CDS       T08091                                 
Name
(GenBank) hypothetical protein
  KO
K18239  chorismatase [EC:3.3.2.13]
Organism
parz  Parasaccharibacter sp. TMW 2.1888
Pathway
parz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
Brite
KEGG Orthology (KO) [BR:parz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DTQ13_05210
Enzymes [BR:parz01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.13  chorismatase
     DTQ13_05210
SSDB
Other DBs
NCBI-ProteinID: UPO79787
UniProt: A0A8U0BCF7
LinkDB
Position
1140689..1141627
AA seq 312 aa
MATICYGGASGGLDVRNGRVYMTLPGSLPATCEQWCPASLSGETRHEQAARGRQAGLEQG
IGWSAEGDLLFAAFWVEDQPELCEAVQTSYERLIGLAQGKGFGHIYRMWNYLGAINQDNA
RGEERYRDFCSGRSQAFEAMSIGLGELPAATGIGLSSGGVAVFLIAHRHVGGVNLENPSQ
LPAYHYPPRYGRRSPSFARATVMEGPDRTALYLSGTASIRGHESVGTTVEEQLSVTIETI
NSLLDAARKRFPRLEAGRFESMKLYVRHSEDAALVREGISRAFQCPLEKSPLFIADICRA
ELLLEVEGVFLG
NT seq 939 nt   +upstreamnt  +downstreamnt
ttggccacgatctgctatggaggggccagtggtgggctggatgtgcggaatggtcgtgtc
tacatgacattgcccgggtctttgccggcgacctgcgaacagtggtgtccagcatcccta
tcgggtgagacccggcacgaacaggctgccagaggccggcaggcagggctggaacagggg
atcggctggagtgcagaaggtgatctgcttttcgctgccttctgggtggaagaccagccg
gagctctgcgaggcggtgcagaccagttacgaacggctgatcggcctggcgcagggcaag
ggttttggccacatctatcggatgtggaattatctgggggccatcaatcaggacaatgcc
cggggtgaggaacggtatcgggatttctgtagtggtcgttcccaggcgtttgaagccatg
agcatcggtttgggtgagctgcctgcggcaacgggcattggcctctcttccggtggtgtg
gctgtcttcctgatcgcccatcgtcatgtgggtggtgtcaatctggagaatcccagccag
cttcctgcctatcattacccgccccgttatgggcggcgttcaccgtcctttgcccgtgcc
accgtcatggaaggcccagatcggacagctctgtatctctccggcacggcgagcatccgg
ggacatgaatccgtcgggacgacggtggaggagcagctctctgtcacgattgaaacaatc
aattcattgcttgatgcggcccggaaacgttttccccgtcttgaagcagggcgctttgag
agcatgaagctctatgtccgtcattctgaagatgcagcgctcgtgcgggagggtatttca
cgggccttccagtgcccgctggagaagtccccgctcttcattgccgacatctgccgggca
gagctgttgctggaggtcgagggggtgtttctggggtga

DBGET integrated database retrieval system