KEGG   Peribacillus asahii: BAOM_2460
Entry
BAOM_2460         CDS       T06700                                 
Symbol
bioI
Name
(GenBank) biotin biosynthesis cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
pasa  Peribacillus asahii
Pathway
pasa00780  Biotin metabolism
pasa01100  Metabolic pathways
pasa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:pasa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BAOM_2460 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pasa00199]
    BAOM_2460 (bioI)
Enzymes [BR:pasa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     BAOM_2460 (bioI)
Cytochrome P450 [BR:pasa00199]
 Cytochrome P450, bacteria type
  CYP107 family
   BAOM_2460 (bioI)
SSDB
Motif
Pfam: p450 NAD_binding_5
Other DBs
NCBI-ProteinID: AZV43069
UniProt: A0A3Q9RN55
LinkDB
Position
complement(2379625..2380854)
AA seq 409 aa
MTNDIKQKLEVPNITPFSLSSPEFLRNPYPIYDNLRSNNPIYRGNSFKYPGWYITGYEEA
VTILKDHINFKSRTPLPQTSKKYEHLKNMQNDMMLFKNQHDHKRLRMLVSKVFSPSVVED
YRPYIEETVNDLLNKVQNKRQMDVVTDFAFPLASLIIAKILGVPSEERNQFREWAVSLIE
TIDFTRTKATLVNGNDTTMLLIVYFKKLIKKRKQAPQDDLISMLIREEQHGDRLTDEELL
ATCILLVIAGHETTVNLISNSILTLLNHPEQLRMLKENPLLIKTAVEEFLRYESPTQMTA
RIALEDIEMNGVTIKKGEQVYIMLGAANRDPKKFVEPNVLDITRNLNPHLAFGYGIHFCL
GSSLARLEAQIAIQTLLQQMEHLQLATSDLQWRKLIGFRSLKELLVTFN
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgacaaacgatataaaacaaaagctagaagttccgaacataacaccattttcactttct
tctcctgagtttctaagaaatccttaccccatttatgataatttacgttctaataaccct
atttatagggggaattcatttaaatatccgggttggtatataactggctatgaagaggct
gtaacgattcttaaagaccatataaattttaaaagtcgcaccccgctgcctcagacatcg
aaaaaatatgaacatcttaaaaatatgcagaacgatatgatgctttttaagaatcaacat
gatcataaacgtttacgcatgttggttagtaaagtatttagtccaagtgttgtggaagat
tatcgtccttatatagaagaaacagttaatgacttactgaataaggtgcaaaataagagg
caaatggatgttgttacagattttgcatttcctttagctagtctcattatagctaaaata
ttaggggtaccatcagaagagcgcaatcaattcagggaatgggctgttagcttaatcgaa
acaattgattttactcggacaaaagcgacattagtaaatggaaacgatacaacgatgctg
ttaatcgtttattttaaaaagctaatcaaaaaacggaagcaagcccctcaagatgatctt
attagcatgttaataagggaggaacaacatggtgacaggttaacagatgaagaattactc
gcaacatgtattttacttgttattgctggacatgagacaacagtaaacctcattagcaat
tcgattctaaccttattgaatcacccagagcaattaaggatgttaaaggaaaatccatta
ctgattaaaacagcagttgaggaatttttacgctatgaaagcccaacacagatgaccgct
cgtattgcattagaagatattgaaatgaatggagtcaccattaaaaaaggcgagcaagta
tacataatgttaggagcagcgaatcgtgatccgaaaaaattcgttgaacccaatgtgctc
gatatcactagaaacttgaatcctcatcttgcatttggatatggaattcacttttgttta
ggatcatcattagcacgtcttgaagcacaaatagctattcaaacactcctgcaacaaatg
gagcatcttcaattagctacatctgacctacaatggagaaaactaattggttttagatca
ctaaaagaactgctggtcacttttaattaa

DBGET integrated database retrieval system