Pseudomonas aeruginosa UCBPP-PA14: PA14_65310 Help Entry PA14_65310        CDS       T00401                                  Symbol hfq Name (GenBank) putative host factor-I protein   KO K03666   host factor-I protein Organism pau  Pseudomonas aeruginosa UCBPP-PA14 Pathway pau02024   Quorum sensing pau03018   RNA degradation Brite KEGG Orthology (KO) [BR:pau00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     PA14_65310 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     PA14_65310 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pau03019]     PA14_65310 (hfq)    03036 Chromosome and associated proteins [BR:pau03036]     PA14_65310 (hfq) Messenger RNA biogenesis [BR:pau03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      PA14_65310 (hfq) Chromosome and associated proteins [BR:pau03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     PA14_65310 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ABJ14329 UniProt:  Q02F74 LinkDB All DBs Position complement(5819787..5820035) Genome browser AA seq 82 aa AA seqDB search MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVRLPSGDQPAEPGNA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacctcaataccctgcggaaagaacgcgtc ccggtttccatctatctggtcaacggcatcaagctgcaaggccagatcgagtccttcgac cagtttgtcatcctgctgaagaacaccgtcagccagatggtttacaagcacgcgatctcc accgtggtaccgagccgtccggtgcgtctgccgagcggtgaccagccggccgagccgggc aacgcttga

DBGET integrated database retrieval system