KEGG   Polyangium aurulentum: E8A73_014200
Entry
E8A73_014200      CDS       T08107                                 
Name
(GenBank) phosphoenolpyruvate synthase
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
pauu  Polyangium aurulentum
Pathway
pauu00333  Prodigiosin biosynthesis
pauu01100  Metabolic pathways
pauu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pauu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    E8A73_014200
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: UQA61551
LinkDB
Position
3573476..3576265
AA seq 929 aa
MADSPTRAAVSTPTDAAAYQSVLRPLASVGGRRRGDAKRVGGKAASLSRLVREGLPVPRG
WVLDASHFTRFVEEVLPRGHDLSSLIKLAGTRAAVDRAARARDRILQTPLSDAVRAAIDA
LWAEIADEAPWGLAVRSSATCEDGEETSFAGLATTVLGARGPEALGAAIRQVWASSFLPR
AIDYLAHAGIRDASMAVLVQVMVEAEAAGVLFTAPPPGLEGDHWGSNERLINATVGLGAP
VVDGAMAADAMRLSRDGGAVIAQVVVEKKRALVVGASGVEEVAVPEPRANRPALSAEALR
ELSALAERLEKGGGGPFDVEFAVAREPSGDARVWLLQVRPLRGGGFPEGGDVDTVWSRAN
VGEALPGAATPLTWSIAQRFSDKGFREAFGALGCRVPRGAQLVTNVHGRFYLNLTAFMQI
AAQVPLLTPRALLSASGGAGEAAIATLERQTANVSKRRFLVRLPFIAPRVLSRQARLERE
VAAYEVEAERARRALAEMDLGLLPDDALAHTMKTASALLDRTGTLMLACASASLASHLAL
GRLLERVASRRASARPAGGEEVINAGAGVEPIVQALAGGVRELDSAGPGVALARIALRAR
EEEEAQARLLAGAVRTPADLPEGPTRRALERFLDMFGDRAVREAELATPRWSEDPATVVA
MLVSALRSQDSDPDRALARARALADREMAGLETRLGPVELAAVRALVARSQRFTRLRERM
RTWVTRVLGMLRTIALDVDRRLRRIEPGLPEGSVFFCTYEELIAALASGRAEVGHVVRLR
RAEHLRDAARPDPPPTFIGRPPPVQLPPVEGTRLQGLPASGGVVEGRARVLEPGTGGLDA
VCAGEVLVTRTTDIGLSPLFLVAAAVVTELGGPLSHAAVVAREYGIPAVVNVPGATVAIR
TGDRLRVDGDRGIVERIDEPPAATGDAPP
NT seq 2790 nt   +upstreamnt  +downstreamnt
gtggccgattctcccacgcgcgcagccgtttccacccccacggacgcagccgcataccag
agcgtcctgcgaccgctcgcctcggtcggcggtcggcgacgcggtgatgcgaagcgggtc
ggcggcaaggcggcgagcctgtcgcggctcgttcgcgagggtttgcccgtgccgcgagga
tgggtgctcgacgcgtcgcacttcacgcggttcgtcgaggaggtgctgccgcgcggtcac
gacctctcgtcgctgatcaagctcgcgggcacgcgcgcggccgtcgatcgcgccgcgcgc
gcgcgtgatcgtatcctgcaaacgcccctgtccgacgcggtgcgcgccgcgatcgacgcg
ctctgggccgagatcgcagacgaggcgccgtgggggctcgcggtgcgctcgagcgcgacg
tgcgaggacggcgaggagacgagcttcgcggggctcgcgaccacggtgctcggggcgcgc
gggcccgaggcgctcggcgcggccatccggcaggtgtgggcgagctcgtttctgccgcgc
gcgatcgactacctcgcccacgccggcatccgcgacgcctccatggccgtgctcgtgcag
gtgatggtcgaggccgaggcagcaggggtgctcttcacggcgccgcccccaggcctcgag
ggagatcattggggctccaacgaacggctgatcaacgcgaccgtcggtctcggcgcgccg
gtcgtcgacggcgcgatggctgcggacgcgatgcggctgtcgcgcgacggcggcgcggtg
atcgcgcaggtcgtggtggagaagaagcgcgcgctcgtcgttggtgcgtccggcgtcgag
gaggtcgcggtgccggagccgcgcgcgaaccgtccggcgctctcggccgaggcgctgcgc
gagctgtcggcgctcgccgagcggctcgagaagggaggcggcggtcccttcgacgtcgag
ttcgcggtggcgcgcgagccatcgggcgacgcccgcgtgtggctgctccaggtgcgcccg
ctgcgcggcggaggttttcccgagggcggcgacgtcgacacggtctggtcgcgcgccaac
gtgggcgaggcgctgccgggcgcggccacgcccctcacctggtcgatcgcgcagcgcttc
tcggacaagggctttcgtgaggcgttcggcgcgctcggctgccgcgtgccccgcggcgcg
cagctcgtgaccaacgtgcacggccgcttctacctgaacctcacggccttcatgcagatc
gccgcgcaggtcccgctgctcacgccgcgcgcgctcctgtccgcgagcggcggggcaggg
gaggccgcgatcgcgaccctcgagcggcagacggcgaacgtctcgaagcgccgctttctc
gtgcgtctgccgttcatcgcgccgcgcgtgctgtcgcgtcaggcgaggctcgagcgcgag
gtggcggcctacgaggtcgaggcggagcgggctcgacgcgcgctcgcggagatggacctc
ggcctgctccccgatgacgcgctcgcccacaccatgaagaccgcgagcgcgctgctcgat
cgcaccggcacgctgatgctcgcgtgcgcgtcggcctcgctcgcgagccacctcgcgctc
ggacgtctgctcgagcgcgtcgcgtcgcgccgcgcatcggcgcgtccagcgggcggcgag
gaggtgatcaacgcaggcgcgggcgtcgagccgatcgtgcaagccctcgcgggcggggtg
cgagagctcgacagcgcggggcctggcgtcgcgctcgcgcgcatcgcgcttcgggcgcgg
gaggaagaggaggcgcaagcgcggctgctcgctggtgcggtgcgcacgcctgccgatctg
cccgaaggcccgacgcgcagagcgctcgagcggttcctcgacatgttcggcgaccgtgcg
gtgcgcgaggcggagctggcgacgcccaggtggagcgaggatccggcgacggtcgtcgcc
atgctcgtctcggcgttgcgctcgcaagacagcgatccggaccgcgcgctcgcccgtgct
cgcgcgctcgcggatcgcgagatggcggggctcgagacgcgcctcggcccggtggagctc
gcggccgtgcgggcgctcgttgcgcggtcgcagcgcttcacgcggctgcgcgagcgcatg
cggacgtgggtgacgcgcgtgctcggcatgctgcgcacgatcgcgctcgacgtggatcgg
cgcctgcggcgcatcgagccggggctgcccgagggctcggtcttcttctgcacctacgag
gagctcatcgcggcgctcgcgagcggtcgcgccgaggtcggtcacgtcgtgcgtcttcgc
cgcgccgagcacctgcgcgacgcggcgcgccccgatcctccgccgaccttcatcggccgc
ccgccgccggtccagctgccgcccgtcgaggggacgcggcttcagggtctgcctgcgagc
ggcggcgtcgtcgaaggtcgcgcgcgcgtgctcgagcccggcacgggcgggctcgacgcg
gtgtgcgcgggcgaggtgctggtcacgcgaacgaccgacatcggcctctcgccgctcttc
ctcgtcgccgcggcggtcgtgacggagctcggtgggcccctgtcgcacgcggccgtggtg
gcgcgcgagtacggcatccccgccgtcgtgaacgtccccggcgcgaccgtggcgattcgc
acgggcgaccggctgcgcgtcgacggcgatcgaggaatcgtcgagcgcatcgacgagcct
cccgcggccacgggcgacgctcccccctga

DBGET integrated database retrieval system