KEGG   Prunus avium (sweet cherry): 110745870
Entry
110745870         CDS       T05161                                 

Name
(RefSeq) cytochrome P450 71A1-like
  KO
K00495  phenylacetaldehyde oxime monooxygenase [EC:1.14.14.44]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00460  Cyanoamino acid metabolism
pavi01100  Metabolic pathways
pavi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    110745870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pavi00199]
    110745870
Enzymes [BR:pavi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.44  phenylacetaldehyde oxime monooxygenase
     110745870
Cytochrome P450 [BR:pavi00199]
 Cytochrome P450, plant type
  CYP71 family
   110745870
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 110745870
NCBI-ProteinID: XP_021801710
UniProt: A0A6P5R9W9
LinkDB
Position
Unknown
AA seq 526 aa
MALLTLLNQIWQEGQLQSSTSSFNIFLVPILFLSIFILFSLTRSSSPSEKNQKLKLPPSP
PRLPWIGNLHQLGSFPHRSLRALSKKYGDVMFMHFGKVPTLIVSSAEMAKDVMKTQDIVF
CSRPQTTAPSILFYDGHDIAFAPYGEYWRQVRRICVLELLSLKRVHQFQYARVEEVAELV
SKIRKASASANGAPINLGELLVSTSNNIICRCILGQKFEDKEDNWFGETTKELMTQVMSF
SFGDFFPSLKWIDRARGYLAYLKSIWLEFDKFFDKLIDEHKAAQKEGKPRKKDIVDILLD
VQKDGSLDFELTTSNVKAILQDMFVGGSDTSWTAAIWLMSELLQNPRVMKKVQEEVRRVA
GKRGYVEESDLNEMKYLTCVIKENLRLHPPAPLLLPRETMSDVKLGGFDIPAKTQVFVNA
YAVQRDPKVWDKPDEFMPERFEENNVGFVGQDFELIPFGAGRRVCPGLAFGVASAQYVLA
NMLYWFDWKLPSGGSKLAETLDMSEVYGLTVHKKSPLYLVPTPYSP
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggctcttctaacacttctcaatcaaatttggcaagaagggcagctgcagagcagcacc
agttccttcaacattttcctggttcctattctcttcctttcaatattcatcttgttttca
cttactagatcatcctcaccaagtgagaaaaaccagaaactcaaattgccaccttcccca
ccaaggctgccttggattggaaaccttcaccagctaggctcattcccacaccgctctctt
cgagctctgtcgaagaagtatggcgatgtaatgttcatgcactttggcaaagttccaact
ctgatagtttcatctgcagagatggccaaggacgtgatgaagacccaagacattgtgttc
tgcagcaggcctcaaactactgctccaagcatattgttttacgacggccatgacattgcg
tttgctccttacggggagtactggagacaagttcgaagaatttgtgttcttgagcttctg
agcctcaaaagagtgcaccagtttcagtacgcaagggtggaggaagttgcagagttggtc
agcaagattcgcaaagcctccgccagcgcgaacggtgctcccattaatcttggggagctg
ctggtgtcaacctccaacaacattatctgcaggtgcattcttggacagaagtttgaggac
aaagaagacaattggtttggagagaccacaaaggagttgatgactcaggtgatgagtttc
agctttggagatttcttcccttctttgaaatggattgaccgtgccagaggctaccttgca
tatttgaaatcaatttggttagaatttgataaatttttcgataagttgattgacgaacat
aaggcagcacaaaaagaaggtaagcctcgtaagaaggatattgtggatattctcctcgac
gttcaaaaggacggctcactcgactttgagctcactacctccaatgtcaaagcaattctg
caggacatgtttgtgggtggaagtgatactagttggacagcagcgatctggttaatgtct
gagcttttgcaaaatccacgggtgatgaagaaagtccaagaagaggtaagaagagtggcg
gggaaaaggggatacgtagaggagagtgacctcaacgaaatgaaatacctgacatgtgtg
atcaaagaaaatttgagacttcaccctccagctcctcttttacttcctcgggaaacaatg
tctgatgtaaaattgggaggtttcgacatccctgcgaagacacaagtgtttgtgaatgca
tacgcagtacaaagagaccccaaagtctgggacaagccagatgagtttatgccagagagg
tttgaggagaacaacgttggtttcgtgggtcaggactttgaactcatcccatttggtgct
gggagaagggtgtgccctggacttgcctttggggttgcttcagcgcaatatgtgcttgcc
aatatgctatattggttcgactggaagttgcctagtggtggcagtaaattggctgagacc
ttggacatgtcagaagtttacggtctcacagtccataagaaaagtcctctttatcttgtt
ccaacaccatactccccttga

DBGET integrated database retrieval system