Pseudomonas avellanae: BKM03_18660 Help Entry BKM03_18660       CDS       T05369                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism pavl  Pseudomonas avellanae Pathway pavl00261   Monobactam biosynthesis pavl01100   Metabolic pathways pavl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pavl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BKM03_18660  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pavl01008]     BKM03_18660 Polyketide biosynthesis proteins [BR:pavl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BKM03_18660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AVB21016 UniProt:  A0AAD0DZM6 LinkDB All DBs Position complement(3937353..3937580) Genome browser AA seq 75 aa AA seqDB search MTSVFDREDIVFQVVVNHEEQYSIWPDYKAIPNGWRTVGKSGFKKECLAYIEDVWTDMRP LSLRQKMEAQTAVSH NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtattcgatcgggaagacatcgtctttcaagttgtggtcaaccacgaagaa cagtactcgatctggcccgactacaaagccatccccaacggctggcgcaccgtcggcaaa agcggcttcaagaaagagtgcctggcctacatcgaagacgtctggaccgacatgcgcccc ctgagcctgcgccagaagatggaagcgcagacggcggtaagtcactga

DBGET integrated database retrieval system