KEGG   Pogonomyrmex barbatus (red harvester ant): 105423705
Entry
105423705         CDS       T04903                                 
Name
(RefSeq) LOW QUALITY PROTEIN: cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    105423705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pbar00199]
    105423705
Enzymes [BR:pbar01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     105423705
Cytochrome P450 [BR:pbar00199]
 Cytochrome P450, animal type
  CYP306 family
   105423705
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105423705
NCBI-ProteinID: XP_011631862
UniProt: A0A6I9VSG3
LinkDB
Position
Unknown
AA seq 521 aa
MSWLLHSFCGKRLVFAGSVLHTTSRFKCFLSIIMISLNLFGLLLILLLIYVLRKNRKTFQ
RLPPGPSGIPIVGYLPWIDAKRPYLTLTELTKKYGPICGLQMGSIYTVLLSDPQLVRQAL
AKDVFAGRAPLYLTHGIMQGYGIVCAEGDRWRDQRKFVAGCLKNFGMVKLSGTKRDRMEE
RILAAVNESISRLKRLPMEGGIDPLETLHHCLGNLMNDLVFGKVYENHDEVWKYLRYLQE
EGVKHIGVAGPLNFLPFLRFLPRYKKIMTLLIGGKIKTHQIYQKIIDDYRARPEKTDNFL
AAFNEAMSKADNEYYTQQQYYHLLADLYGAGVDTTLATFRWILLFMALYPDEQKKIQNEM
NELLGQKQPILEDRPLLIRLEAAILESQRLRSITPVGIPHGAIEDTQLNGYDIPKGTMII
PLQWAIHTNPMYWDDPLSYKPERFITEDGSIVKPKAFLPYQMGKRMCVGDELAKMILFLF
TARFLHSFIISVPLDTQLDMEGICGLTLVPKSHRLIFTSRE
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtcatggctactacatagtttctgtggcaaaagattggtgttcgcaggttcggttcta
cacacaacatcgcgtttcaagtgcttcctctctatcataatgatatcccttaatctcttc
ggcttattgctcatacttttacttatctatgttcttcgtaaaaatcgaaagacgttccaa
agacttccaccgggaccatctggcatcccaatagtcggctatctaccatggatagatgcc
aaacgtccttacctaacgttgacagaattgacaaaaaaatatggtcctatttgtgggcta
caaatgggttctatatacacggtcttgttgtcggatccgcagctggtaaggcaggcctta
gctaaggacgtatttgccggcagggctccactctacttgacacatggaataatgcaagga
tatggtatcgtttgtgccgagggtgaccgttggagagatcaaagaaaatttgtagctgga
tgtctgaagaattttggtatggtcaaattatccggtaccaagagggacagaatggaggaa
aggattctcgcggccgtgaatgagagcatatcgagattgaaaaggcttcctatggaaggc
ggtattgatccgcttgagacgcttcatcactgtctgggtaatttaatgaacgacctcgtg
ttcggaaaagtttatgagaatcatgacgaagtgtggaaatacctgagatatctgcaagag
gaaggagtcaagcacattggagtcgcagggccactcaactttctgccgttcctcagattt
ttaccgcgatataaaaaaataatgacgttacttatcggtggaaagataaagacgcatcaa
atatatcaaaagattatcgacgattatcgtgctcgacctgaaaaaacggataactttctc
gcagctttcaacgaagcaatgagtaaagcggataatgagtattacacgcagcaacaatat
tatcatttgttagctgatctttatggagcaggtgttgataccacactcgcaacttttcgt
tggatcctgctcttcatggcattgtatcctgacgagcaaaaaaagattcagaatgaaatg
aacgagctattgggacaaaaacaacctattttggaggatagacctcttctaatccgattg
gaagcggctattttggagtcacaaagattgcggagcattacaccggttggcatccctcac
ggagcaatagaggatacacaattaaatggttacgacataccgaaaggcaccatgataatt
ccgttacaatgggctattcacacgaatcccatgtactgggacgatccgctctcatacaaa
cctgagagatttattactgaagatggaagcatcgtcaaaccgaaagcttttttgccatat
cagatgggtaaacgtatgtgtgttggtgacgaactggccaagatgatattatttctcttt
accgcaagatttcttcactcatttattatttccgtaccacttgatacgcaactcgatatg
gaaggtatatgcggacttactctggttcctaaatcacaccgtttgatttttacatcgcgg
gaataa

DBGET integrated database retrieval system