Pseudomonadaceae bacterium T75: OS670_14075 Help Entry OS670_14075       CDS       T08742                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pbau  Pseudomonadaceae bacterium T75 Brite KEGG Orthology (KO) [BR:pbau00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pbau03036]     OS670_14075 Chromosome and associated proteins [BR:pbau03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     OS670_14075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  USHBP1_PDZ-bd ZapB Matrilin_ccoil LicD Coilin_N YabA Motif Other DBs NCBI-ProteinID:  WAD25541 LinkDB All DBs Position complement(3037674..3037883) Genome browser AA seq 69 aa AA seqDB search MDDADLQLLTHKLEQLIQRIEQLKAQNGLLLANEQAWREERAHLIEKNELARVKVEAMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggacgacgccgatctgcaactgctgacccataaactggagcagctcatacagcgcatc gaacagctcaaggcccagaacggcctgctgctcgccaacgagcaggcatggcgcgaagag cgcgctcatctgatcgaaaagaacgaattggcccgggtgaaggtcgaagcgatgatttcg cgcctgaaagccctggagcaggactcatga

DBGET integrated database retrieval system