Pseudomonas brassicacearum DF41: CD58_02815 Help Entry CD58_02815        CDS       T03174                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism pbc  Pseudomonas brassicacearum DF41 Pathway pbc02024   Quorum sensing pbc03018   RNA degradation Brite KEGG Orthology (KO) [BR:pbc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     CD58_02815  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     CD58_02815  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pbc03019]     CD58_02815    03036 Chromosome and associated proteins [BR:pbc03036]     CD58_02815 Messenger RNA biogenesis [BR:pbc03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      CD58_02815 Chromosome and associated proteins [BR:pbc03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     CD58_02815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AHL31892 UniProt:  A0AAQ0TEQ3 LinkDB All DBs Position 633785..634045 Genome browser AA seq 86 aa AA seqDB search MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAIS TVVPVRPIRLPSATETEGGDAEPGNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacttgaacactttacgtaaagagaaagtt ggggtgtccatctatctggtcaacgggatcaaactgcaaggcacgatcgagtctttcgac cagttcgtcatccttctgaaaaacaccgtcagccagatggtctacaagcacgcgatctcg acagtcgtgccagttcgtccaattcgtctgcctagcgcaaccgaaaccgaaggcggtgac gctgagccgggtaacgcctga

DBGET integrated database retrieval system