Prionailurus bengalensis (leopard cat): 122466943 Help Entry 122466943         CDS       T07574                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04080   Neuroactive ligand-receptor interaction pbg04081   Hormone signaling pbg04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     122466943 (GHRH)    04081 Hormone signaling     122466943 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     122466943 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pbg04052]     122466943 (GHRH) Cytokines and neuropeptides [BR:pbg04052]  Neuropeptides   GPCR binding    122466943 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  122466943 NCBI-ProteinID:  XP_043409194 LinkDB All DBs Position A3:22329429..22334892 Genome browser AA seq 106 aa AA seqDB search MLLWVFFLVILTLDSGSHCSPPSLPLRMPRYADAIFTNSYRKVLGQLSARKLLQDIMSRQ QGERNQEQGAKVRLGRQVDSVWAGQKQMALESILVALLQKHRNSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctggtgatcctcaccctcgacagtggctcccactgctcc ccgccatccctgcccctcagaatgcctcggtatgcagatgccatcttcaccaacagctac cggaaggtgctgggtcagctgtctgcccgcaagctactgcaggacatcatgagcaggcag cagggagagagaaaccaggagcaaggagcaaaggtacggcttggccgtcaggtggacagc gtgtgggcaggtcaaaagcagatggcgttggagagcatcctggtggccctgctgcagaag cacaggaattcccaaggatga

DBGET integrated database retrieval system