KEGG   Prionailurus bengalensis (leopard cat): 122471410
Entry
122471410         CDS       T07574                                 
Name
(RefSeq) integrin alpha-X-like isoform X1
  KO
K06462  integrin alpha X
Organism
pbg  Prionailurus bengalensis (leopard cat)
Pathway
pbg04610  Complement and coagulation cascades
pbg04810  Regulation of actin cytoskeleton
pbg05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pbg00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    122471410
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    122471410
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    122471410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pbg04515]
    122471410
   04090 CD molecules [BR:pbg04090]
    122471410
Cell adhesion molecules [BR:pbg04515]
 Integrins
  Integrin alpha subunits
   122471410
CD molecules [BR:pbg04090]
 Proteins
  122471410
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha FG-GAP_2 VWA_CoxE
Other DBs
NCBI-GeneID: 122471410
NCBI-ProteinID: XP_043415892
LinkDB
Position
E3:complement(17682846..17733193)
AA seq 1159 aa
MTMIRTFLLLMGLASSLCFNLDTDQPTTFLMESAGFGYSVVQYANSWVVVGAPQEIKAAN
QTGSLYQCDYRTGKCEPIRLKIPPEAVNMSLGLSLAASTKPSQLLACGPTVHHTCKENMY
LTGFCFLLVSPSWQAQKLPAALKECPRQEQDIVFLIDGSGSISFRDFTKMLNFVKAVMSQ
FQRPSTQFSLMQFSHHSWVHFTFKDFIYSSNPLGLLDSVQQLRGFTYTATAIQMVTNQLF
SASRGARKDASKILIVITDGQKQGDPLGYEDVIPRAEAAGIIRYAVGVGLAFQNPHSQKE
LNDIASKPSHEHIFQVENFDALRDIQNQLKEKIFAIEGTQTISSSSFELEMSQEGFSAVF
SPDGPVLGAVGSFSWSGGAFLYPQNMSPTFINMSQENVDMRDSYLGYSTELALWKGVKIL
ILGAPRHQHTGKVVIFTQASGQWRPKAEVAGTQIGSYFGASLCSVDVNRDGNSDLVLIGA
PHYYKPTRGGQVSMCHLPLGRARWQCEVILCGEQGHPWGRFGAALTVLGDVNGDKLTDVA
IGAPGEQENRGAVYLFHGTSELGINPSHSQRISGSQLSPSLQYFGQSLSGGQDLTLDGLV
DLAVGAQGQVMLLRTRPVLRVWMNIQFTSSEIARSVFECREETASVKALGDANVCLRIYE
SPKNQLGDIQSSVTFDLTLDPGRQNPRAIFEETKARNLTHVRVLGLRQYCETVRLLLLAC
VEDSVTPITLRLNFSLVGKPIPSFGNLQPILAVDAQRYFVASLPFEKNCGTDHVCQDDLG
ISFDFSGLKTLVVGSTLELNMKVTVWNDGEDSYGTTITFFYPPGLSYRRVAGSQNQLQAH
SPSLTCDGTPAQGQSTQSTRCSINHLIFHEGAKMTFVVTFDVSPKAILGDRLLLTANVSS
ENTTPRTSKTTFQMELMVKYAIYTVISSHEESTKYLNFSALDWEESSQAQHRYQVNNLGQ
RDLPVSINFSVPVELNGVPVWTELGVFHPQNPSIQCSSERMVPIESDFLTHIQKNPVLNC
SIADCLRFHCDLPSFGVQEELDFIVKGNLSFGWVSQTLQKKVLIVSVAEIMFNTSVYAQL
PGQEAFLRAQMEMVLEKYEVYNPVPIIVGSSLGGLLLLALITVILYKVGFFKRQYKEMME
EANGQTIPENGTSDPQASQ
NT seq 3480 nt   +upstreamnt  +downstreamnt
atgaccatgatcaggaccttcctcctgttgatgggcttggcttcttctctctgtttcaac
ttggacacagaccagccaacaaccttccttatggagagtgctgggtttggatacagtgtg
gtccagtatgccaactcctgggtggtggttggagccccccaggagataaaggctgccaac
caaacaggtagcctctaccagtgtgactatagaacgggcaagtgtgagcccatccgcctg
aagatccccccagaagcagttaacatgtccttgggcctgtccctggcagcctcaaccaaa
ccctctcaactgctggcctgtggccccacagtgcaccatacatgcaaggagaacatgtac
ttgactgggttctgtttcctgctggtttccccttcctggcaggcccagaagctcccggct
gccctgaaggagtgtccgaggcaggagcaggatattgtgttcctgatcgatggctcaggc
agcatctccttcagagattttaccaagatgttgaattttgtgaaggccgttatgagccag
ttccagagacctagcacccagttctctctgatgcagttctcccaccattcctgggtgcac
ttcactttcaaagacttcatatacagctcaaacccactaggcctgttggattcggtacaa
cagctgcgagggttcacttacacagctacagccatccaaatggttacaaatcaactgttc
agtgcctcaaggggggcccgaaaagatgcctccaagatccttattgtcatcactgatggt
cagaaacaaggagaccccctgggttatgaggatgttatccctagggctgaagctgccggt
atcattcgctatgcagttggggtgggattggcttttcaaaatccacattcccagaaagaa
ttaaatgacattgcatcgaagccctcccatgagcacatttttcaagtggagaattttgat
gctttgagagacattcaaaaccaactgaaagagaagatctttgccattgagggtacgcag
accataagcagtagttcctttgaattggagatgtcccaagagggtttcagcgctgtgttc
tcacctgacgggccagttctgggggctgtggggagcttcagctggtctggaggagccttc
ctatacccccaaaatatgagccccactttcatcaacatgtctcaagagaatgtggacatg
agggactcttatctaggttactccactgagctggcactttggaagggggtgaagatcctg
atcctgggggccccccgccatcagcatactgggaaggttgtcatcttcactcaggcatcc
gggcaatggaggccgaaggctgaagttgcagggacccagattggttcctactttggggcc
tccctctgctctgtcgatgtgaacagagatggcaactctgacctcgtcctcattggggct
ccacattactacaagccaacccggggggggcaggtgtccatgtgccacttgcccctgggg
agagctagatggcagtgtgaggtcattctctgtggggagcagggccacccctggggccgc
tttggggcagccttgacagtgctgggggatgtgaatggggacaagctgacagatgtggcc
attggggccccaggagagcaggagaaccggggtgctgtctacctatttcatggaacctca
gaactgggcatcaacccctcccacagtcagcggatctcaggctcccagctctcccccagc
ctccagtattttgggcagtcactgagtgggggtcaggaccttaccttggatggactggtg
gacctggctgtgggggcccaggggcaggtgatgttgctaaggaccagacctgtgctcagg
gtgtggatgaatatccaattcacatcttcagagattgccaggtctgtgtttgaatgtcgg
gaagagacagcctctgtcaaggcactgggtgatgccaacgtctgccttcgtatttatgaa
agtcccaagaatcagctgggtgacatccaaagctctgtgacctttgacctgaccctcgac
cctggccgccagaatccccgtgccatctttgaggagacaaaagcccggaatctgactcat
gtccgagtccttgggctgagacagtactgtgagaccgtgaggttgctcctcctggcctgt
gtggaggactcagtgacccccatcaccttgcgtctcaacttctccctggtgggcaaacct
atcccttcctttggaaacctccagcctatcttggctgtggatgctcagcgatacttcgtg
gcctctcttccctttgagaagaattgtggaactgaccatgtctgtcaggatgaccttggc
atctcctttgacttctcaggcttgaagactctggtggtggggagtaccctggagctgaat
atgaaagtgacagtgtggaatgatggtgaagactcctatggaaccacaatcaccttcttc
taccctccagggctgtcttatcgtcgtgtggcagggagccagaaccagctgcaggcacac
tccccaagcctgacctgtgatggcaccccagcccagggccagagtactcagagcacccgt
tgcagcatcaaccacctcatcttccatgagggtgctaagatgaccttcgtggtcaccttt
gacgtctcccccaaggccatactgggtgataggttgcttctgacagctaacgtgagcagt
gaaaatactactcccaggaccagcaagaccacctttcagatggagctcatggtgaagtat
gccatctacactgtgatcagcagccatgaagagtccaccaagtacctcaacttctcagcc
ttggactgggaggaaagcagccaggctcagcatagataccaggtgaacaatctgggacag
agggacctgcctgtcagcatcaacttctctgtgcctgtggagctgaatggggtgcctgtg
tggacagagttaggggttttccacccccagaacccctccattcagtgttcttcagagaga
atggtgcccatagagtctgacttcctgacccacattcagaagaatcctgtgctgaactgc
tcaattgctgactgcctgaggttccattgtgacctgccttcctttggcgtccaggaggaa
cttgacttcatcgtaaagggcaacctcagctttggctgggtcagccagacattgcagaag
aaggtattgattgtgagtgtggctgaaatcatgttcaacacatctgtgtatgcccagctt
ccaggacaggaggcattcttgagagctcagatggagatggtactggagaagtatgaggtc
tacaaccctgtccccattattgtgggcagctctttgggaggactgctgctgctggctctc
atcacagtcattctgtataaggttggcttcttcaaacgtcagtataaggaaatgatggag
gaagcaaatggacagactatcccagaaaatgggacatcagaccctcaagcttcccaataa

DBGET integrated database retrieval system