KEGG   Prionailurus bengalensis (leopard cat): 122491236
Entry
122491236         CDS       T07574                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
pbg  Prionailurus bengalensis (leopard cat)
Pathway
pbg04927  Cortisol synthesis and secretion
pbg04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:pbg00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    122491236
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    122491236
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 122491236
NCBI-ProteinID: XP_043449675
LinkDB
Position
C2:complement(12881358..12904504)
AA seq 111 aa
MANQTNASTLYDSYEYYLDYVDLIPVDERKLKANKYLIVIAFWVSLAFFVMLLFLILLYM
SWSGSSQVRNNAQHHPIRPWSRGLNLPLCVRRHPTGSPGLGQGARQQSIPP
NT seq 336 nt   +upstreamnt  +downstreamnt
atggccaaccagaccaacgcctccaccctgtacgacagctacgaatactacttggactat
gtggacctcattcccgtggatgagaggaagctgaaagccaacaaatatctgattgtcatt
gccttctgggtgagcctggcatttttcgtcatgcttctcttcctcatcctgctctacatg
tcctggtcaggttcctcgcaggtgaggaacaacgcccagcaccacccaatacgcccctgg
agtcgtggcctcaacctcccgctctgcgtccggaggcaccccacaggctcccccgggctc
gggcaaggagccaggcagcagagcatcccgccctga

DBGET integrated database retrieval system