KEGG   Paracoccidioides lutzii Pb01: PAAG_02515
Entry
PAAG_02515        CDS       T02230                                 
Name
(RefSeq) cytochrome P450 55A1
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00910  Nitrogen metabolism
pbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PAAG_02515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pbl00199]
    PAAG_02515
Enzymes [BR:pbl01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     PAAG_02515
Cytochrome P450 [BR:pbl00199]
 Cytochrome P450, fungi type
  CYP55 family
   PAAG_02515
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 9099127
NCBI-ProteinID: XP_015701714
UniProt: C1GV42
LinkDB
Position
Unknown
AA seq 439 aa
MTPARRYLRGSCGFCRSKSLNSARSALAPRSQCFSMSTESSPPKFPFSRPSEAIPPLEYA
KLRATNPVSRVTLWDNSHPWLVVKHKDICSVLTDQRLSKQRTRPGFPEMNPGGKQAAKNR
PTFVDMDPPEHMHQRSMVASLFTRKHSETMRPHIQAIADILLDEMIQQGCENPVDLVEKF
ALPLPSYIIYGILGVPEHDLVYLTKCNAIRSNGSSTAAAAANANKELLDYIGNLVNKRLE
KPENDMISKLVVEQLKPGDIDRLDAVQIAFLMLVAGNATLVNMICLGVVTLLQNPSQLAD
LRANPSLAPQFVEELCRFHTASAMATRRVAKEDIILGGQHIKAGEGIIAATQSGNRDEEV
FPNPDVFDMYRKRGSETALGFGYGEHTCVAEGLARTEMEVVFSTLFQRLPNLRLGIPQSE
IKYTPADQDVGITELPVVW
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgactccggcaagacgatatttaaggggctcatgcggattttgcagatctaaatcactt
aactctgctcgatcggcccttgctccacgctcccaatgcttcagcatgtctacagaatct
agccctccaaaattccctttctctcgcccatctgaggctataccccctcttgagtatgcg
aaactcagggccacaaatcccgtttctcgagtcacactctgggacaacagtcacccatgg
cttgtggtcaaacataaggacatctgcagtgtccttacagatcaacgtttgtccaagcaa
cgcacccgcccaggtttccctgaaatgaatcctggagggaagcaagctgctaaaaaccgc
ccgactttcgttgatatggaccctcctgaacacatgcatcagaggagtatggttgcgtcc
cttttcaccaggaagcattctgagacaatgcgtccgcatattcaagccattgccgatatt
ctcctggatgaaatgatccaacagggctgtgaaaatcccgtagatttggttgagaagttt
gctctgcccctcccatcctatatcatatacggaattttgggggttccggagcatgacctt
gtgtatctcaccaaatgtaatgctattcgcagtaatggaagttctaccgctgcagctgcg
gctaatgctaataaggaactcctggattacattggaaatttggtcaataaacgacttgaa
aaaccggagaatgacatgattagcaagttggttgtcgaacagcttaaaccgggggatatt
gacaggctagatgccgtccaaatcgcattcttgatgctggtcgctggaaatgccacctta
gtcaacatgatctgtctcggcgtcgtaactcttcttcagaaccccagtcaactggcagac
ctcagagccaatccgtctctggcgccccagtttgttgaggaactttgccgcttccacacg
gcttctgctatggccacaagacgagttgctaaagaggatatcatccttggtggccaacac
ataaaagcaggggaaggcataattgctgccacccaatccggcaaccgggatgaagaagtc
ttccccaacccagacgtcttcgatatgtaccgtaagaggggatctgagacggcccttggc
tttgggtatggcgaacacacttgtgtcgctgaggggttggctcgtactgagatggaagtt
gttttttcaacgttgttccaacgacttccaaatcttagacttgggatcccgcaatccgaa
atcaagtatacccccgcagatcaagacgttggcataactgagctcccagttgtctggtag

DBGET integrated database retrieval system