KEGG   Petaurus breviceps papuanus (sugar glider): 138169057
Entry
138169057         CDS       T10505                                 
Name
(RefSeq) calmodulin-1-like
  KO
K02183  calmodulin
Organism
pbrv  Petaurus breviceps papuanus (sugar glider)
Pathway
pbrv04014  Ras signaling pathway
pbrv04015  Rap1 signaling pathway
pbrv04020  Calcium signaling pathway
pbrv04022  cGMP-PKG signaling pathway
pbrv04024  cAMP signaling pathway
pbrv04070  Phosphatidylinositol signaling system
pbrv04114  Oocyte meiosis
pbrv04218  Cellular senescence
pbrv04261  Adrenergic signaling in cardiomyocytes
pbrv04270  Vascular smooth muscle contraction
pbrv04371  Apelin signaling pathway
pbrv04625  C-type lectin receptor signaling pathway
pbrv04713  Circadian entrainment
pbrv04720  Long-term potentiation
pbrv04722  Neurotrophin signaling pathway
pbrv04728  Dopaminergic synapse
pbrv04740  Olfactory transduction
pbrv04744  Phototransduction
pbrv04750  Inflammatory mediator regulation of TRP channels
pbrv04910  Insulin signaling pathway
pbrv04912  GnRH signaling pathway
pbrv04915  Estrogen signaling pathway
pbrv04916  Melanogenesis
pbrv04921  Oxytocin signaling pathway
pbrv04922  Glucagon signaling pathway
pbrv04924  Renin secretion
pbrv04925  Aldosterone synthesis and secretion
pbrv04970  Salivary secretion
pbrv04971  Gastric acid secretion
pbrv05010  Alzheimer disease
pbrv05012  Parkinson disease
pbrv05022  Pathways of neurodegeneration - multiple diseases
pbrv05031  Amphetamine addiction
pbrv05034  Alcoholism
pbrv05133  Pertussis
pbrv05152  Tuberculosis
pbrv05163  Human cytomegalovirus infection
pbrv05167  Kaposi sarcoma-associated herpesvirus infection
pbrv05170  Human immunodeficiency virus 1 infection
pbrv05200  Pathways in cancer
pbrv05214  Glioma
pbrv05417  Lipid and atherosclerosis
pbrv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pbrv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    138169057
   04015 Rap1 signaling pathway
    138169057
   04371 Apelin signaling pathway
    138169057
   04020 Calcium signaling pathway
    138169057
   04070 Phosphatidylinositol signaling system
    138169057
   04024 cAMP signaling pathway
    138169057
   04022 cGMP-PKG signaling pathway
    138169057
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    138169057
   04218 Cellular senescence
    138169057
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    138169057
  09152 Endocrine system
   04910 Insulin signaling pathway
    138169057
   04922 Glucagon signaling pathway
    138169057
   04912 GnRH signaling pathway
    138169057
   04915 Estrogen signaling pathway
    138169057
   04921 Oxytocin signaling pathway
    138169057
   04916 Melanogenesis
    138169057
   04924 Renin secretion
    138169057
   04925 Aldosterone synthesis and secretion
    138169057
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    138169057
   04270 Vascular smooth muscle contraction
    138169057
  09154 Digestive system
   04970 Salivary secretion
    138169057
   04971 Gastric acid secretion
    138169057
  09156 Nervous system
   04728 Dopaminergic synapse
    138169057
   04720 Long-term potentiation
    138169057
   04722 Neurotrophin signaling pathway
    138169057
  09157 Sensory system
   04744 Phototransduction
    138169057
   04740 Olfactory transduction
    138169057
   04750 Inflammatory mediator regulation of TRP channels
    138169057
  09159 Environmental adaptation
   04713 Circadian entrainment
    138169057
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    138169057
  09162 Cancer: specific types
   05214 Glioma
    138169057
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    138169057
   05163 Human cytomegalovirus infection
    138169057
   05167 Kaposi sarcoma-associated herpesvirus infection
    138169057
  09171 Infectious disease: bacterial
   05133 Pertussis
    138169057
   05152 Tuberculosis
    138169057
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    138169057
   05012 Parkinson disease
    138169057
   05022 Pathways of neurodegeneration - multiple diseases
    138169057
  09165 Substance dependence
   05031 Amphetamine addiction
    138169057
   05034 Alcoholism
    138169057
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    138169057
   05418 Fluid shear stress and atherosclerosis
    138169057
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pbrv01009]
    138169057
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pbrv04131]
    138169057
   03036 Chromosome and associated proteins [BR:pbrv03036]
    138169057
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbrv04147]
    138169057
Protein phosphatases and associated proteins [BR:pbrv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     138169057
Membrane trafficking [BR:pbrv04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    138169057
Chromosome and associated proteins [BR:pbrv03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     138169057
Exosome [BR:pbrv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   138169057
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EF_EFCAB10_C EH EFhand_Ca_insen UPF0154 DUF1103 FCaBP_EF-hand EF-hand_EFHB_C EF-hand_11 EF-hand_STIM1 SPEF2_C
Other DBs
NCBI-GeneID: 138169057
NCBI-ProteinID: XP_068954272
LinkDB
Position
Unknown
AA seq 157 aa
MADQLTEEHIAEFKEVFSLFDKDGDGTITTVMRSLGQNPTEAELQDMINEVDADGNGTID
FPEFLTVMARKMKDTDSEEEIREAFRVFDKDDNGYISAAELCHVMTNLGEKLTDKEFDEM
TREADIDGDDQVNYEESVQMMTAKFPPTVKRICMCSN
NT seq 474 nt   +upstreamnt  +downstreamnt
atggctgatcagctgacagaagagcacattgcagaattcaaagaagtcttttcactattt
gacaaggatggagatggtactataacaactgtaatgaggtcacttgggcagaaccccaca
gaagctgaattacaggatatgattaatgaagtagatgctgatggtaatggcacaattgac
tttccagaatttctgactgtgatggcaagaaaaatgaaagacacagacagtgaagaagaa
attagagaagcattccgtgtgtttgacaaggatgacaatggttatattagtgcagcagaa
ctttgccatgtgatgacaaaccttggagagaagttaacagataaagagtttgatgaaatg
accagggaagcagatattgatggtgatgatcaagtaaactatgaagagtctgtacaaatg
atgacagcaaagttcccccctactgtcaaaaggatatgcatgtgtagtaattag

DBGET integrated database retrieval system