KEGG   Physeter catodon (sperm whale): 102981675
Entry
102981675         CDS       T06011                                 
Symbol
ITGAX
Name
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-X
  KO
K06462  integrin alpha X
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04610  Complement and coagulation cascades
pcad04810  Regulation of actin cytoskeleton
pcad05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102981675 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    102981675 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102981675 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pcad04515]
    102981675 (ITGAX)
   04090 CD molecules [BR:pcad04090]
    102981675 (ITGAX)
Cell adhesion molecules [BR:pcad04515]
 Integrins
  Integrin alpha subunits
   102981675 (ITGAX)
CD molecules [BR:pcad04090]
 Proteins
  102981675 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 Integrin_alpha FG-GAP_3 FG-GAP_2
Other DBs
NCBI-GeneID: 102981675
NCBI-ProteinID: XP_023977523
UniProt: A0A2Y9SGG0
LinkDB
Position
14:67888998..67909146
AA seq 1162 aa
MPMSDLPVMTTTRIFLLLLMALASSFCFNLDIDQPTTFHVDSAGFGYSVVQYANWLVVGA
PQEIKAANQTGGLYQCDYSMGKCEPILLPVPPEAVNMSLGLSMVATTSPFRLLACGPTVH
HACRENMHLTGFCFLLVSPSREAQRIPAALQECPRQEQDIAFLIDGSGSISSTNFAKMLN
FVKAMMSQFQSPSSQFSLVQFSNQFRVHFSFKTFAASSNPLSLLNSVEKLNGYTYTASAI
RVVTEQLFSALYGARKDASKILIVITDGQKQRDPLDYKDVIPSAEAAGIIRYAIGVGSAF
QNMYSWQELKVIASEPSHEHIFKVENFDALRDIQNQLKEKIFAIEGTQTISSSSFELEMS
QEGFSAVFTPDGPVLGAAGSFSWSGGAFLYPPNRSPTFINMSQEHADMRDSYLGYSTELA
VWKGVHILVLGAPRHQHTGKVVIFTQVSGQWRPKAEVTGTQIGSYFGASLSSVDVDRDGS
SDLVLIGAPHYXEGGRGGQVSVCPFPRGVSGXXDPGWVGSGCGGVAWGGTXRCFCSAEVT
DVAIGAPGEQEHRGAVYLFHGTSGLGLSPAHSQRITGAQFSPSLQYFGQSLSGGQDLTMD
GLVDLAVGALGHALLLRTRPVLRVWANIHITPPEITKSAYECHQQLAFDQSLGEAIVCLH
VSQSPKNRLGNLQSVVTFDLTLDPGRLSPRAVFEETRTRNLTRVRDLGLTQHCEPVRLLL
PACVEDSVTPIILRLNFSLVGKPVSSFGNLQPMLAVDAQRYFMTSLPFEKNCGADHVCQD
DLGISFGVSGLKTLIVGSNLELNLEVRVWNDGEDSYGTTITFFYPPGLSYRRVAGGQNQL
QSRALRLTCDSAPTGSQGTLSTSCSINHLIFREGTQITFRATFDVSPTATLGDRLLLAAN
VSSENNSPKMSKTTFRLELPVKYAVYTVISSHEQSTKYLNFSASEEEESSGAQHRYQVNN
LGQRDLPVSIDFSVPVALNRLPVWEVTEALHPQNPSFQCSSERTAPTESDFLTHFQKKPV
LDCSIADCLRFRCDIRSFGVQEELDFILKGNLSFGWVNQTLQKKVSVVSVAEITFNRSVY
SQLPGQEAFLRAQTELVLEKYEVYNPTPIIVGSSVGGLLLLALITATLYKVGFFKRQYKE
MMEGANGQTSPENGTGDPQVSQ
NT seq 3489 nt   +upstreamnt  +downstreamnt
atgcccatgtctgaccttccagtcatgaccacgaccaggattttcctcctcctgttgatg
gccctggcttcctctttctgcttcaacttggacatagaccagccaacaaccttccatgtg
gacagtgctgggtttggatacagcgtggtccagtatgccaactggctggtggttggagcc
ccccaggagataaaggcggccaatcaaacgggcggcctctaccagtgcgactacagcatg
ggcaagtgtgaacccatcctcctgccggtgcctccagaggctgtgaacatgtccctgggc
ctgtccatggtggccaccaccagcccctttcggctgctggcctgtggccccaccgtgcac
catgcctgcagggagaacatgcacttgaccgggttttgcttcctgctggtctccccgtcc
cgggaggcccagaggatcccggctgccctgcaggagtgcccgaggcaggagcaggacatt
gccttcctgatcgatggttcaggcagcatctcctccaccaattttgccaaaatgctgaac
ttcgtgaaggctatgatgagccagttccagagtcccagctcccagttctccctggtgcag
ttctccaaccagttccgggtgcacttcagtttcaaaactttcgcagccagctcaaaccca
ctaagcctgctgaactccgtagagaagctgaatgggtacacgtacacggcctcagccatc
agggtggtcacagaacagctgttcagtgccttatatggggcccgaaaagatgcctccaaa
atcctcatcgtcatcactgatgggcagaaacaacgtgaccctctggattacaaggatgtc
attcccagtgctgaggccgctggcatcatccgctatgcaattggggtgggatcggctttt
caaaatatgtattcctggcaagaattaaaggttatcgcgtcggagccctcccatgaacat
atatttaaagtggagaactttgatgctttgagagacattcaaaaccaactgaaagagaag
atctttgccattgagggtacgcagaccataagcagcagttcctttgaactggagatgtcc
caggagggcttcagtgctgtgttcacgcctgatggaccagttctgggggctgcggggagc
ttcagctggtctggaggtgccttcctgtaccccccaaataggagccccaccttcatcaac
atgtctcaggagcacgcggacatgagggactcttacctgggttactccacagagctggcc
gtttggaagggggtacacatcctggtcctgggggccccccgccatcagcacaccgggaag
gttgtcatcttcacccaggtgtccgggcaatggaggccgaaggctgaagtcacagggacc
cagatcggctcctacttcggggcctccctcagctccgtggacgtggacagagatggcagc
tccgacctggtcctcatcggggccccccattactaggaggggggccgggggggccaggtg
tccgtgtgcccctttccccggggggtgagtggctgatgagacccgggctgggtggggtct
gggtgtggaggggtcgcctggggtgggacctgacgctgtttttgttccgcagaggtgacg
gacgtggccatcggggccccgggagagcaggagcaccggggcgctgtctacctgtttcac
ggaacctcgggactgggcctcagccccgcccacagccagcggatcacaggcgcccagttc
tcccccagcctccagtattttgggcagtcgctgagcgggggtcaggacctcaccatggat
ggactggtggacttggctgtgggggccttggggcacgcgctgctgcttaggaccagacct
gtgcttagggtgtgggcaaacatccacatcacacctccagagatcaccaagtctgcgtat
gagtgccaccagcagctggcctttgaccagtctctgggtgaggccattgtctgccttcat
gtttctcaaagtcccaagaaccggctgggtaacctccaaagcgttgtgacctttgaccta
acccttgaccctggccgcctgagtcctcgtgctgtcttcgaggagacaaggactcggaat
ctgactcgtgttcgagacctggggctgacacagcactgcgagcctgtgaggttgctcctg
ccggcctgtgtggaggactcggtgacccccatcatcttgcgtctcaacttctccctagtg
ggcaagcctgtctctagctttggaaacctccagcctatgctggcagtggatgcccagaga
tacttcatgacctctctcccctttgagaagaactgtggtgccgatcatgtctgccaggat
gacctcggcatctcctttggggtctcaggcttgaagaccctgattgtggggagtaacctg
gagctgaacttggaagtgagagtgtggaatgatggcgaggactcctatggaaccacaatc
accttcttctacccgccggggctatcttatcgacgtgtggcagggggccagaaccagctg
cagtcacgtgccctgcgcctgacctgtgacagtgcccccaccgggagccagggcaccctc
agcaccagctgtagcatcaaccacctaatcttccgtgagggcacccagatcaccttcagg
gccacctttgacgtctcccccacggccacgctgggagaccggctgcttcttgcagccaat
gtgagcagtgagaataacagccccaagatgagcaagaccaccttccggctggagctcccg
gtgaagtacgctgtctacaccgtgatcagcagccatgaacagtccaccaagtacctcaac
ttctcggcctccgaggaggaggaaagcagcggggctcagcacagataccaggtgaacaac
ctgggacagagggacctgcctgtcagcattgacttctcagtgcccgtggcgctgaaccgg
ttgcccgtgtgggaggttacggaggccctccaccctcagaacccatcctttcagtgctct
tcagagagaacagcacccacagagtccgacttcctgacccactttcagaagaagcctgtc
ctggactgctccattgctgactgcctgaggttccgctgtgacatccgctccttcggcgtc
caggaggaacttgacttcatcctgaagggcaatctcagcttcggctgggtcaaccagaca
ctgcagaagaaggtgtcggtcgtgagtgtggctgagatcacgttcaacagatccgtgtat
tcccagcttccaggacaggaggcatttttgagagcccagacggagctggtgctggagaag
tatgaggtctataaccccacccccattattgtgggcagctctgtgggaggactgctgctg
ctggctctcatcacagccacactgtacaaggtcggcttcttcaaacgtcagtacaaggaa
atgatggagggagcaaatggacagacatcgccagaaaatgggacaggagacccccaagtt
tcccagtaa

DBGET integrated database retrieval system