Phalacrocorax carbo (great cormorant): 104043369 Help Entry 104043369         CDS       T08596                                  Name (RefSeq) histone H2A-beta, sperm-like   KO K11251   histone H2A Organism pcao  Phalacrocorax carbo (great cormorant) Pathway pcao03082   ATP-dependent chromatin remodeling pcao04217   Necroptosis Brite KEGG Orthology (KO) [BR:pcao00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     104043369  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     104043369  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcao03036]     104043369   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcao04147]     104043369 Chromosome and associated proteins [BR:pcao03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104043369 Exosome [BR:pcao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104043369 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Cdc6_lid TAFII28 Motif Other DBs NCBI-GeneID:  104043369 NCBI-ProteinID:  XP_009501274 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MAGLQFPVGRVYRFLKRGNYADRISPGAAIYLAAVLEYLTAEILELAGNAAQENKKSRIL PRHIQLAARNDDELNELFSSVTIPQGGVLPNIVPELLPKKTISLRPPHKYVQSQEF NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggctggtctgcagttccctgtgggtcgtgtctacaggttccttaaaagagggaactac gctgacaggatcagtcctggtgctgccatctacctggctgctgtgctggagtacctgacc gcagagatcctggagctggcagggaatgctgcacaggaaaacaagaaatccaggatcctg cccaggcacatccagctggctgcgagaaatgatgatgagctgaacgaactcttctcctct gtgaccatccctcagggaggggtgttacctaatattgttcctgagcttcttcctaagaag accatctcacttagaccaccccacaaatatgtccagtcacaagagttctag

DBGET integrated database retrieval system