KEGG   Persicimonas caeni: FRD00_12650
Entry
FRD00_12650       CDS       T06769                                 
Name
(GenBank) hypothetical protein
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
pcay  Persicimonas caeni
Pathway
pcay00333  Prodigiosin biosynthesis
pcay01100  Metabolic pathways
pcay01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcay00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    FRD00_12650
SSDB
Motif
Pfam: PPDK_N PEP-utilizers Peptidase_M60
Other DBs
NCBI-ProteinID: QED32786
LinkDB
Position
3410199..3412901
AA seq 900 aa
MYSTLTLAGHMNKRAEHSVVETTPAADIDYHYTVRVGASDWPQARVGGKADGLHRLVRHG
FTVPRAFCILTDAFERVVARCVKHASSLDELRAQILEAPLPDGLFDEISARMDAIGAPLW
AVRSSALEEDTLAHSFAGQQATVLEVETPEEVVQAVRHVWASLYDVQGLLYRNQLKVDLE
PRPMAVVVQRMVSPSAAGVMFTQNPVTADPTRLVINAASGLGTTVVGGGAADTYYLEKKT
GYVERHEVGSHGADSHGAEEGGVLDSAQLDELAACARRLDELFDHPQDVEWAYAPQSRAE
AESGIRGKLFLLQARPITQFGEAQQPSVWTNVNVGEALPGVATPLTWSIIRNFSRRGFEQ
AFGSLGLTVPEDYELVGSFRGRVYLNLSQFMSVASAIPILSPDTLFEMAGGGGVDLVRGI
YESKSPVKFLAKLPVTAVRVVASQLSMPVLAPMWGKYFEVRRDAFFQRDLSRLNHLEFSR
QLDGVDSLFDRTGLVMLACSSNFLMSYVVMRELLKLWGGPKAAKSEKELVSALEVDSAAP
GLDLLNLGRLARRSRRLRRVISNTPPADVLTELESLRGHDDVDVFMDELDRFRRRHGHRA
PREAELATPRWREDTHFLFEVVRSYIRAPHLPTERELQRERERTRKLADQLVGRTFPVGL
ESVFRALLEFTRSNVKLREFMRARVVDSLDMYRRYFLECGRRLVLQDALRQPEDVFYLRY
DELRDWLADVSTADDFATRVLVRRALHDSLAELADPPSTFVLEGSEIVDEDEYRKRRAPE
SSRSDNSLHRVDELHGLPGSAGKVTGRARVITDPNDDASIEPGEILVAPYTDVGWTPLFL
TASGVVMGLGGPLSHSCIVAREYGIPTVVNAHGAVDTINTGDLITVDGDRGVVYIRERSF
NT seq 2703 nt   +upstreamnt  +downstreamnt
atgtactcgactcttacgctcgctgggcacatgaacaaacgagctgagcattctgtggtc
gaaacaactccagcggccgatatcgactaccattacacggtgcgcgtcggggcgagcgac
tggccccaggcacgcgtgggcggcaaggccgacgggctgcacaggctcgtgcgccacggg
tttacggtgccgcgcgccttctgcattctgaccgacgccttcgagcgggtggtcgcccgc
tgcgtcaaacacgcgagcagcttggacgagttgcgcgcgcagatcttggaggcgccgctt
cctgacgggctattcgacgaaatctcggcacgcatggacgccatcggcgccccactgtgg
gcggtgcgctcctcggcgctcgaagaagacactttggcgcacagcttcgccggtcaacag
gccacggtgctcgaggtcgagacgcccgaagaggtcgttcaggccgtacgccatgtgtgg
gccagcctctacgacgtccaaggcctgttgtaccgaaaccagctcaaggtcgacctggag
ccccgccccatggcggtcgtcgtccagcgcatggtttcgccgagtgccgccggggtgatg
ttcacccaaaatccggtgactgccgatccgactcggctggtcatcaacgccgccagcggg
ctgggcaccaccgtggttggcggtggggcggcagacacttactacctcgagaaaaagacc
ggctacgtcgagcgtcatgaagtcggctcacacggggccgactcgcatggggccgaagaa
ggtggcgtgctcgactcagctcagctcgacgaactcgccgcctgcgcgcgccggctcgac
gagctcttcgaccatccgcaggacgtcgaatgggcgtacgcgccccagtcgcgcgccgag
gccgaaagtggcattcgtggcaagctcttcttgctgcaggcgcgccccatcacccaattc
ggcgaggcccaacagccgtcggtgtggaccaacgtcaacgtcggagaggcgcttccgggg
gtggccacgccgctgacctggagcatcatccgcaacttcagccgccgcggcttcgagcag
gccttcggctcgctgggattgacggtgcccgaggactacgagctggtgggctcgtttcgc
ggccgggtgtacctgaacttgtcgcagttcatgagcgtggccagcgccattccgatttta
agcccggacacgctcttcgagatggccggcggcggcggggtcgacctggtgcgcggcatc
tacgagagcaaaagcccggtgaagtttctggccaaactgccggtcaccgcggtgcgggtc
gtcgcctcgcagctgtcgatgcccgtgctcgctccgatgtggggcaagtacttcgaggtg
cgccgagacgcctttttccagcgcgacttgagcaggctcaatcacctggagttttcgcgt
cagctcgacggggtcgacagtctcttcgaccgcaccgggctagtcatgttggcgtgcagc
tcgaacttcttgatgagctacgtcgtcatgcgcgagctcttgaagctttggggcggaccc
aaagcggccaagagtgaaaaggagctggtgagcgcgctcgaggtcgacagcgccgccccc
ggcctcgacctgctcaacctgggtcggctggcgcgccgctcgcgcaggcttcgccgggtc
atcagcaatacgccgccggccgacgtgctcaccgaactcgaaagccttcgtggccacgac
gacgtcgacgtcttcatggatgagctcgaccggttccgccgccgccacggccaccgtgcc
ccgcgcgaggccgagctggccacgccgcgctggcgagaggacacccactttttgttcgag
gtggtccgcagctatatccgcgcgccgcacctgccgaccgagcgcgagttgcagcgagag
cgcgagcgcacccgcaagctcgccgaccaactcgtgggccgcacctttccggtcggcctc
gagtcggtctttcgcgcgctgctcgagtttacccgctccaacgtcaagctgcgcgagttc
atgcgcgcccgagtggtcgacagcctcgacatgtaccggcgctactttttggagtgcggc
cgacgcctggtgctccaagacgcgctgcgccagcccgaagacgtcttctacctgcgctac
gacgagctgcgcgactggctcgccgacgtcagcaccgccgacgacttcgccacccgcgtg
ctggtgcgccgcgcgctgcacgactcgctggccgagctggccgacccaccgagcacgttc
gtgctcgagggaagcgagatcgttgacgaagacgagtaccgcaagcgtcgcgcacccgaa
tcgagccggtcggacaacagtctgcaccgcgtcgacgagctgcacggtttgcccggaagc
gccggcaaagtgaccggacgcgcccgcgtcatcaccgacccgaacgacgacgcctccatc
gagccgggcgaaatcttggtcgccccctacaccgacgtgggctggacgccgctcttcttg
accgcctcgggcgtcgtcatgggcctgggcggccccctgagccactcgtgcatcgtcgcc
agagagtacggcatccccaccgtggtcaacgcccacggcgcggtcgacaccatcaatacc
ggtgatctgatcaccgtcgatggagatcggggcgtggtctacattcgcgagcgatcgttc
tga

DBGET integrated database retrieval system