Piscinibacterium candidicorallinum: ACMDW7_09335 Help Entry ACMDW7_09335      CDS       T10926                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pcaz  Piscinibacterium candidicorallinum Pathway pcaz02024   Quorum sensing pcaz03018   RNA degradation Brite KEGG Orthology (KO) [BR:pcaz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     ACMDW7_09335 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ACMDW7_09335 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pcaz03019]     ACMDW7_09335 (hfq)    03036 Chromosome and associated proteins [BR:pcaz03036]     ACMDW7_09335 (hfq) Messenger RNA biogenesis [BR:pcaz03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      ACMDW7_09335 (hfq) Chromosome and associated proteins [BR:pcaz03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     ACMDW7_09335 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 SRP14 Motif Other DBs NCBI-ProteinID:  XOD95353 LinkDB All DBs Position complement(2073040..2073282) Genome browser AA seq 80 aa AA seqDB search MNKGQALQDPFLNQLRKEHVPVSIYLVNGIKLQGHIESFDQYVVLLRNTVTQMVYKHAIS TVVPARAVNFSTDGGSEAAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaacaaagggcaagcgctacaagacccgttcctcaaccagcttcgtaaggagcatgtc ccggtctccatctatctggtgaacgggatcaagttgcagggccacattgaatcgttcgat caatacgtggttctgcttcgcaataccgtcacccaaatggtctacaagcacgccatcagc accgttgtgcccgcacgtgccgtgaacttcagcacggatggtggtagcgaagccgcatcg tga

DBGET integrated database retrieval system