KEGG   Paenibacillus cellulosilyticus: HUB94_17785
Entry
HUB94_17785       CDS       T07813                                 
Name
(GenBank) amino acid adenylation domain-containing protein
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
pcel  Paenibacillus cellulosilyticus
Pathway
pcel01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:pcel00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    HUB94_17785
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:pcel01008]
    HUB94_17785
Polyketide biosynthesis proteins [BR:pcel01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    HUB94_17785
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: QKS46079
LinkDB
Position
complement(3517737..3525467)
AA seq 2576 aa
MTAMQEGMLYHRLVDDSVGHYFVQNMIRFDCKLDAGCVEQSLLLLAQKHAVLRTSIFYKK
VKQPRNIILKDRTIGFSAVDLTDLSALAKNERLAEIKRLDAENHFDLEKDPLMRVCLVKM
EEQHYKLLWSFHHIIMDGWCMSLVMKDFLDNYTLLQSGKPLKALLQEMQEASRGSAKYED
YIKWLSAQDKGRSLEYWGRLLSDYEQGAEIPPLLVGHESTKQADSVKASLTKDTSEGLLK
LSHQLNCTVNTIVETAWGLLLQTYNGTGDAVFGKVVSGRNADIRGIEHTVGLFINTIPVR
VNNSKNLRFSQLIQELQEQSLESNLHDFCSLVEIQEKSSLKDQLIRTLVAFENYYVDEEL
GEGGGLPFEVESMEEQTSYPITLLVHVADTLKMEVLYDAGLYGQLEMERLLDTLSRLLIA
MVQSPEAKIHEVDLLSEAEKKQILIDFNQTELAYEKSKTLHELFEEQVLRTPGHHAVTFN
QEHMTYEALNQRANQLARTLRKGNTSGARIIGIMVSRKPEMLIAILAVLKSGYAYLPIDP
EYPLERIQHMLEDSGAAILLTEDPIMAALDLDFHGEIIDVQREGSYDADSSNLPSISAAE
DLAYVIYTSGSTGKPKGVMIEQSSVHNLIEGVSRQIRFTEGKSILNLTTISFDIFVIETI
LPLLKGMRVVIMDEAGQKDSSLIIEAIQREQINIVQTTPSRMKILIGENATIEHVFSSVQ
EIIVTGEALPKHLANTLKTLFSCEIYNMYGPTETTVWSALQNVRSENKVTIGKPLANTKA
YIVNSHQQIQPIGIYGELCISGDGVARGYLNRPELTQEKFTDNPFSQGERMYRTGDLARW
LPDGTIEYFGRMDEQIKIRGYRIELGEIESAIRKQTGIRDVAVIAKSDSSGDKYICAYVV
SDQPEQEADAAQIKQELRKVLPSFMIPAYIIGLNKLPVTANGKLDRRSLPEPVNQRKEHI
VAPRNSLEETLADIFKEVLGLEQLSIHDHFFEIGGHSLKATRVVNMTEAKTSLRIPLKVF
FERSTIAELSEYLAACQNEAVYHPIPLSESKDVYPLSPAQRRVFYIHQMDDLGTVYNMPG
VLEIRGKLNVGRVKDVIRQLTERHESLRTSFIVSGDHPVQRIEDSVEVEVEVDEGLMSVE
ALQSYAEVAAMSKGAVEENQALKLMAEDLLQPFVRPFHLEEAPLIRVKVVKAAEEHYLLM
FDMHHIITDGASMNTITKEFSLLYNGQALKTPHIQYKDYCEWMSARDLGGQEAYWTEQFS
GEIPVLELPLDFPRQQTKQYTGSSIHVSLNGTVKSDIRELCKQTGTTEYMLLLSAFMILL
GKYSGQEDIVIGSPVSGRTHQDTEALVGMFVNTLAMRGRPERGKTFTAFLQEMKEICLKA
MDHQEYPFEELVDKVQVQREMSRHPLFDVMFALQDMEEEWTAEGLTFNMVELENKAAKFD
LTMIVNHTDDGYDMTWEYSDKLFKEETVHRMAVHFEQIIREAVRQPWIPLQDIDVATPAE
KQQILFDFNNTRSLYPKEKSIQQLFQEQVIRTPDAEAVISEQGVLTYEQLDQRSDEISGE
LQRRGIQAGQLIGIVSEKSADMIAGILAIVKCGCGYVPLDGDYPESRLRFMLEDCQIDTI
LHGSGTIGTGAWIPEGTHRIDIRERYEGFNLAPYAASPSDTAYVVYTSGSTGVPKGVVVS
HQNVVRLVQHTDYVDFSDARILQTGALSFDATTFEIWGSLLNGGVLCLVDSDIFANPGKL
ADLVEQNRLNTMFLTSQLFNNLVDLDMRWMKGMKNILTGGQAISERHVNKLLQHHQGLTL
IHCYGPTENTTFSLTYKVEHPQVNIPIGQPIGNSTAYIMNGSILSGIGLPGELCVGGDGV
AKGYLNRDELTREKFIENPYVPGERIYRTGDLARWLPDGNIEFLGRMDEQVKIRGYRIEL
GEIETVLRQQDGIKDAAVLVRKDGEEDRYLCAYIVGEDQEQAVNLTQLKDKIRQELPAYM
IPAYFVQLEQLPATANGKLDRRALPQPEQTTMQTYAAPRNDLETILTDVFSEVLGLERVG
IDDSFFEMGGDSIKAIRIISKLREHGYELDVKTLIQHREIRTISSKVQKAQADNLEIYQQ
PVAGVVQRTPIQHQFYEWELSRPEHFNQAIMIHSAGGFNEDLVRTALEQLAKHHDALRSR
FDERGTHSICGVDEGQLYELTVVEYRDLGDADALAQAVEEHCNAIQASMDLKKGPLLKAA
LFHANDGTHLFFCVHHLVVDGVSWRILLEDFSTAYSQARDHQTISLPSKTASYQAWAEGL
IAFSKSYLLKRELGYWKEVSHKIDASVPLSETACYKDAQKLSGAAVTVNHEFMLTREETD
RLLHESGTAYNTEINDLLLAALSMTVQQCFGVGSVGIELESHGRHPIEPQIRIDRTVGWF
TNTYPVVLECHTDDLGATIKHTKETLRKVPNYGLGYGILKYLSDPEIRTQLAPLQLELSF
NYLGDFSSEGDGGEFSFSKLGCGSVSSDENKFQKPITVDCIVQEGQMAFTIGFNHSEMDV
HTRFSEVFAASLRTIIAHCSSHTGTQYTLSDYGDEIGWSDSELDDVLSLFEGDEND
NT seq 7731 nt   +upstreamnt  +downstreamnt
ttgaccgccatgcaagaaggcatgctgtatcataggttggttgacgacagcgtgggccac
tattttgtccagaatatgatccggtttgactgcaagctggatgcgggttgcgtagagcaa
agtttattgttactcgcccagaagcatgcggttttaagaacatccatcttttataaaaaa
gtgaagcagccgcggaatattatcctgaaggacagaaccatcggattttccgccgtggat
cttacggatctctctgctctcgcgaaaaatgagcggctagcagaaatcaagaggctggac
gcagagaaccattttgatctggaaaaagacccgttgatgagagtttgcctggtgaagatg
gaggagcagcattacaagctgctctggagcttccatcatattattatggacggctggtgc
atgtcgttagtaatgaaggatttcttggacaactacaccttattacagagcggcaaacct
ctgaaagctctccttcaagagatgcaagaagcttcaagaggaagcgctaagtatgaagat
tatatcaaatggctgtccgcacaagacaagggacgttctttggaatactggggacggttg
ctgtcggattatgagcagggggcggaaattccgcccttgcttgtcggtcatgagtcaacc
aaacaggcggattctgtaaaagcaagtctcaccaaagatacaagcgaaggactcttaaag
ctgagccatcaattaaattgtacagtgaatacgattgtggaaacggcctgggggctgctt
ctgcaaacatataacggtacgggtgatgcggtttttggaaaagtagtatctggtagaaac
gctgacattcgcggaatcgaacatacagtggggctgtttattaatacgattcctgtccgc
gtaaacaactctaagaatcttcgtttcagccaactaatccaggagctgcaggaacagtct
ttggagagcaacctgcatgatttctgttcattagtagaaattcaggaaaagagcagtctg
aaggatcaattaatccggacgctcgttgcatttgaaaattattatgtggatgaagagctg
ggcgaaggcggcggattgccatttgaagtggagagcatggaggagcaaacgagctatccg
attacattgctcgtgcatgtggcagatacgttgaaaatggaagtattatatgatgccggt
ctgtatggccaattagaaatggaaaggcttttggacacgttaagccgccttctcattgca
atggttcaatcgccggaagccaaaattcatgaggttgacctcttatcagaagccgagaaa
aagcaaattctgattgattttaatcaaacagagttggcgtacgagaagagcaagaccctt
catgagttgttcgaagaacaagtactaagaactcctgggcatcatgcagtcaccttcaat
caggagcatatgacttatgaggcattgaatcaaagagccaatcagctagcacgtaccctt
agaaaaggcaacacctccggcgctagaattatcggaattatggtaagccggaaaccagaa
atgcttatcgccattcttgctgtgctgaaatcgggctatgcctacctgccgattgacccg
gaatatccgttggaacggattcagcatatgctcgaggatagcggggcggccattcttttg
acagaagatcctatcatggctgcactggacctcgatttccatggggaaataatagatgta
cagcgtgagggcagctacgatgcagattcctctaatttgccctccatctcggctgcagag
gatttggcttacgtcatttacacttcgggttcaaccggaaagcccaaaggcgtcatgatt
gagcaatcgtcggtacataatctgatcgaaggagtaagccggcagattcgctttacagaa
gggaaaagtatactgaatctgacgacgatatcctttgatatttttgtaatcgaaacgatt
cttcccctgctgaagggtatgcgtgttgtcattatggatgaggccggacaaaaggattcg
tcattgattattgaagcaatccagagagaacagattaacattgtgcaaaccaccccgtcg
agaatgaagatattgatcggcgagaatgccactatcgaacatgtttttagcagcgtacag
gaaataatcgtaacgggagaagcgcttcccaaacatttggccaatacgctgaaaacgttg
ttctcttgtgaaatctacaatatgtacggccctaccgaaactaccgtatggtccgcgctg
caaaatgtcagaagcgaaaataaagtgacgatcgggaaaccgctcgccaacacgaaggct
tatatcgtaaacagtcatcagcaaattcaacctattggtatctacggggagctgtgcatc
tctggagatggagtcgctagaggatatttgaatcggccagagctgacacaggagaaattt
acagataaccccttctcccaaggcgaacggatgtaccggacaggggatttggcgagatgg
cttcctgacggaacgatcgaatactttggcagaatggatgagcaaatcaagataagagga
taccggatcgagctcggggagattgaaagtgcgataagaaaacagacaggtattcgggac
gttgctgtcatcgcaaagtcagactcatcgggagacaagtacatatgcgcgtatgtggtt
tcagatcaaccggagcaagaagcggatgcggcgcaaatcaaacaggagcttcggaaagta
ctgccttcatttatgattccggcctatattattgggcttaacaagctgcctgtaaccgcc
aatggtaagctggatcgacggtctcttcctgaaccggtcaatcagcggaaggagcacatt
gttgcgccaagaaacagcctggaagagacgttagctgacatatttaaagaagtattagga
ctggagcagcttagcattcatgaccatttcttcgaaatcgggggccattcgctgaaggcg
acgcgcgtcgtgaatatgaccgaagccaagacgagcttaagaattccgttaaaagtattt
ttcgaacggtcaacgatcgccgaattaagtgaatacttagcagcttgccaaaatgaagct
gtgtatcatcctatccctttgtcggaatccaaagacgtttatccgttatcacccgctcaa
cggagagtattttatatacatcaaatggatgatttgggtacggtgtataacatgccaggc
gttctggaaatccgcggcaagctgaatgttggcagggtgaaggatgtaatccggcagtta
accgaaagacatgagagcttaaggacaagctttattgtatctggggatcatccggtgcag
cggatcgaggattcggttgaagttgaggttgaagtggatgaaggcttgatgtctgtggaa
gcgctccagtcctacgcggaagttgccgcaatgtcgaagggggcagtggaggagaatcag
gcactgaagctgatggcagaagatcttcttcagccattcgttcgtccttttcatttggag
gaagccccattaattcgggttaaagtggtcaaagcggcagaagagcattatttgcttatg
tttgatatgcaccacatcattacggacggggcgtcgatgaatacgatcaccaaagagttc
tcgctgctttataacgggcaagcgttgaaaaccccgcacatccaatacaaggactactgt
gaatggatgagcgcaagggatttgggtggtcaagaggcttattggacagaacagttcagc
ggtgaaattcccgtacttgagcttccgttagactttcctagacagcagactaaacagtac
acaggttcttctattcatgtaagtcttaacggaactgtaaagagcgacatccgcgagctg
tgcaaacaaacaggaactacagagtatatgctgctgctgtctgctttcatgattttgtta
ggcaaatacagcggccaagaggatatcgtcatcggaagtccggtatcaggcagaacgcat
caggatacagaagctttggtgggcatgttcgtcaacacgcttgcgatgcgggggagacct
gaaaggggtaaaacctttactgccttcctgcaagaaatgaaagaaatatgtctgaaagcg
atggatcatcaggagtacccgtttgaagaactggttgacaaagttcaagtacagagagag
atgtccagacaccctcttttcgatgttatgtttgcgctgcaggacatggaagaggaatgg
acagcggagggcttgacgttcaatatggtcgaactggagaacaaggcagccaagtttgat
ctgactatgattgttaatcacaccgatgatgggtatgacatgacctgggagtacagtgac
aagctgtttaaagaagagacggttcacagaatggccgttcatttcgaacagatcatccga
gaggcggttagacagccttggataccgcttcaagatatcgatgttgcgactcctgcggaa
aaacaacaaattttgtttgattttaacaacacccgctccctctatccgaaagagaagtcg
atccagcagctgttccaagaacaggtcatcagaacgccagatgccgaggcagtaatatcc
gagcagggtgtgctgacctatgaacaattggaccaacggtcggatgaaatctcgggtgaa
ttgcagcgcagagggatacaagcaggacaactgatcggcatcgtatccgagaagagcgca
gacatgattgcgggcatactggcgattgtgaaatgcggttgcgggtatgtgccactggat
ggcgattatccggagagcagactccgctttatgcttgaagattgccagatcgatacgatc
ctgcacggttcgggaactatcgggacgggggcttggattccagaggggactcataggata
gacatccgggagcgttatgagggattcaacttagccccgtatgctgcttccccttcggat
actgcctatgtcgtttatacttcaggttcaacaggggtgcctaaaggcgttgtcgtctct
catcaaaatgtagtcagactcgttcagcataccgattatgtggatttcagtgacgcgaga
atattacagaccggcgccttatcttttgacgcaacgacatttgaaatttggggttctcta
ttaaatgggggagtgctctgtctcgtagacagtgatatttttgcaaatcccggaaagctg
gcggatttagttgaacagaaccgcctcaatacgatgtttttgacctcccagctgtttaat
aacttggtcgatctcgatatgagatggatgaaggggatgaaaaatatcctcactggcggc
caagccatctccgagagacatgtgaacaagctgctgcagcatcatcagggtcttaccctt
attcactgctatggtccgactgaaaatacgacgttctccctgacatacaaggttgaacac
ccgcaggtcaacataccgattggccaaccgattggcaacagtacagcctatattatgaac
ggcagcattctaagcggcatcggacttccaggcgagctgtgcgtaggcggagacggcgtt
gcaaaaggttatttgaaccgggatgagctgacccgtgagaaattcatcgaaaatccgtat
gttccgggtgaacgtatctatcggacaggtgacctggccagatggctgccggacggcaat
atcgagttcttgggccgaatggacgagcaggtgaagatcagaggataccggattgagctt
ggggagatcgaaacggttctccgtcagcaggatggaatcaaagatgccgcagtgctggtc
aggaaagatggcgaagaagaccgatatctgtgtgcttatatagtcggcgaagatcaggag
caggccgttaacctgacacaactaaaggataagatcaggcaagaactgccggcttatatg
atacccgcctatttcgtgcagcttgagcaattgcccgcaacggcaaatggtaaactggat
cgccgtgctcttccacaaccggaacaaacgaccatgcaaacttatgcagcgccgagaaat
gacttggaaacaatattgacggacgtcttcagtgaagttctcgggctggagagagtaggg
atagacgacagcttcttcgaaatgggaggagactcgatcaaggctatccgcatcatctcc
aaattaagggagcacggctatgagctggatgtaaaaacattaatacagcacagagaaatc
cgtacgatcagctccaaagtacaaaaagcgcaagccgacaatttagaaatctaccagcag
ccggtagcgggagtggttcagcggacgccaattcaacatcaattttatgaatgggagctg
tcccgtcctgagcatttcaaccaagcgatcatgatccattcggccggcggatttaacgaa
gaccttgttcgtacagcgctggagcaattggccaagcatcatgatgcgctgcgcagccga
tttgatgagcgcggcacccacagcatttgcggggtagatgaaggacagttgtacgaatta
acggtcgttgaataccgtgatctgggagatgccgacgcattggctcaagcagtagaggag
cattgcaatgcgattcaagcaagtatggatctcaagaagggtcctctgctgaaggctgcc
ttatttcatgcgaatgatggcacgcatctatttttctgtgttcatcatttggttgtggac
ggggtatcctggcgtattctgctggaagatttcagtacagcttattcgcaagcccgtgat
caccaaaccatcagtctgcctagcaagacagcttcttatcaggcttgggctgaagggctg
atcgcattcagtaagagctatctcttgaaaagagagctcgggtattggaaagaggtctct
cacaaaatcgatgcctccgttccgctctcggagactgcctgctacaaggatgcccagaag
ttaagcggggcggctgtgaccgttaaccatgaattcatgcttactagagaagaaacggac
aggctactgcatgagtccggcacagcatataacacggaaatcaatgacctgttattagcg
gccctaagcatgacggttcagcaatgctttggcgtaggaagcgttggcatcgaattggaa
agccacggcagacatccgattgaaccgcagatccgcatcgaccggacggtaggctggttc
acgaatacgtatcctgtcgtgttggaatgccataccgacgacctaggagcaacgattaaa
catacgaaagaaacgctccgtaaagttccgaactatggccttgggtacggtatcttaaag
tatttgtccgacccggaaatcaggacgcagctggcgccgctgcagcttgagctcagcttt
aattatttgggagacttcagcagcgagggtgacggcggggagttttcattctccaagctg
ggctgcggcagcgtaagctccgacgaaaacaagtttcaaaagcctatcacggtggattgt
attgtacaagagggccagatggcatttacgatcggctttaatcattcagagatggatgtg
catacccggtttagtgaggtattcgccgcttctctgcgtacaatcattgcacattgcagc
agccatacaggaacgcaatataccctttcggattatggcgatgagatcgggtggagcgac
agcgaactggacgatgtgctgagtttgtttgaaggagatgagaacgattaa

DBGET integrated database retrieval system