Penaeus chinensis (fleshy prawn): 125030400 Help Entry 125030400         CDS       T08118                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism pchn  Penaeus chinensis (fleshy prawn) Pathway pchn03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:pchn00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     125030400  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pchn03036]     125030400   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pchn04147]     125030400 Chromosome and associated proteins [BR:pchn03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125030400 Exosome [BR:pchn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125030400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone Cdc6_lid Motif Other DBs NCBI-GeneID:  125030400 NCBI-ProteinID:  XP_047476390 LinkDB All DBs Position 11:10341188..10341436 Genome browser AA seq 82 aa AA seqDB search MYTGAGAPVYMAAVMEYLAAEILELAGNAARDNKKSRIVPRHLQLAVRNDEELNKLLSGV IIAQGGVLPNIQAVLLPKKAEK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtacacgggcgctggtgcacccgtgtacatggctgctgtcatggaatacctcgctgct gaaatcctggaattggcaggaaatgccgcccgtgacaacaagaagagccgcatcgtgccc cgtcacctgcagctggccgtccgtaacgacgaagagctcaacaagctgctgtctggcgtg atcattgcccagggcggcgttctgcccaatatccaggctgtgctcctgcccaagaaggcg gagaagtag

DBGET integrated database retrieval system