Proteus columbae: F1325_01210 Help Entry F1325_01210       CDS       T06419                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pcol  Proteus columbae Pathway pcol02024   Quorum sensing pcol03018   RNA degradation Brite KEGG Orthology (KO) [BR:pcol00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     F1325_01210 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     F1325_01210 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pcol03019]     F1325_01210 (hfq)    03036 Chromosome and associated proteins [BR:pcol03036]     F1325_01210 (hfq) Messenger RNA biogenesis [BR:pcol03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      F1325_01210 (hfq) Chromosome and associated proteins [BR:pcol03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     F1325_01210 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 6TM_1st_PGAP2IP Motif Other DBs NCBI-ProteinID:  QHN09160 UniProt:  A0A6I7D6I8 LinkDB All DBs Position 238269..238556 Genome browser AA seq 95 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNTGTNQTGTGYNGGAAQQDDVAE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttgcaagatcctttcttgaacgcattacgtcgtgaaagggtt cccgtttctatctatttggtaaacggcattaaattgcagggtcagatcgaatcttttgac caatttgttattttgctgaaaaacacagtaagtcagatggtatacaaacatgctatctct accgtggtaccttcgcgtcctgtttctcatcatagcaatacaggtacgaaccaaactggt acaggctacaatggtggcgctgctcagcaggatgatgttgcagagtaa

DBGET integrated database retrieval system