KEGG   Proteus columbae: F1325_09535
Entry
F1325_09535       CDS       T06419                                 
Name
(GenBank) hypothetical protein
  KO
K23653  T3SS effector EspM
Organism
pcol  Proteus columbae
SSDB
Motif
Pfam: IpaB_EvcA DUF4943
Other DBs
NCBI-ProteinID: QHN10692
UniProt: A0A6I7D9T7
LinkDB
Position
1976089..1976877
AA seq 262 aa
MTKGVFMINILNKFENKVQNTNPVFNNENLKNYLKLLDNIDDIKNTPLKDISGGYNGKKT
SVNIANISKELISKIRVLYSHEEISSCKINIKNKEKSIRLLNEAYAKADNAILSWWENER
RIFPSSIINRKIDNLNLNKDASANKELNIDKKLKEIIFILTSKKFNLNLDIKAAQSTIIQ
HLQDIPDVVKAIDELGISNDSYSKYETYCLMAEYIYNFLSENKNEVDFSKIKDAVKEIAE
RNLVTPKDRLTSLYSTYTLIFL
NT seq 789 nt   +upstreamnt  +downstreamnt
atgacaaaaggagtttttatgataaatattttaaataaatttgaaaataaagttcaaaat
acaaaccctgtttttaataacgaaaatttaaaaaactatttgaaacttttagataatatt
gatgatattaaaaacacaccattaaaagacatctctggtggttataatgggaaaaaaact
agtgtaaatattgcaaatatcagcaaagaattaatatcaaaaatacgagttctttatagc
catgaagaaatatcctcttgcaagattaatataaaaaacaaagaaaaatcaataagatta
ttaaatgaagcttatgctaaagcagataatgctattttaagttggtgggagaatgaaagg
agaatatttccttcttcaataattaatcgaaaaattgacaatttaaatttgaataaagat
gctagtgcaaataaagaacttaatatagataaaaaacttaaagaaattatatttatttta
acatctaaaaaatttaatttaaatttagatattaaagcggctcaaagtacgataatccaa
cacttacaagatatccctgacgtcgtaaaagcaatagatgaattaggaatttctaatgat
tcatattcaaaatatgaaacttattgtttaatggctgaatatatttacaattttttatca
gaaaataaaaatgaagttgatttttctaaaataaaagatgccgttaaagaaatcgctgaa
cgaaatttggttactcctaaagatagattaacatccctttattctacatatactcttatt
tttttgtga

DBGET integrated database retrieval system