Pandoraea commovens: NTU39_11030 Help Entry NTU39_11030       CDS       T08365                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pcom  Pandoraea commovens Pathway pcom02024   Quorum sensing pcom03018   RNA degradation Brite KEGG Orthology (KO) [BR:pcom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     NTU39_11030 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     NTU39_11030 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pcom03019]     NTU39_11030 (hfq)    03036 Chromosome and associated proteins [BR:pcom03036]     NTU39_11030 (hfq) Messenger RNA biogenesis [BR:pcom03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      NTU39_11030 (hfq) Chromosome and associated proteins [BR:pcom03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     NTU39_11030 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  UVA81494 UniProt:  A0A5E4W334 LinkDB All DBs Position 2359975..2360211 Genome browser AA seq 78 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAI STVVPARPVNFHPEAEQS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaaagggcaacttctacaagacccgtttctgaacgccttgcgtaaggagcat gttcccgtctcgatctatctggtcaacggtatcaagctgcagggaaacatcgagtcgttc gaccagtatgtcgtcctgctgcgcaacacggtcactcaaatggtttacaagcatgccatt tcgacggtcgtgcctgcgcgtccggtgaatttccatccggaagccgagcagtcctga

DBGET integrated database retrieval system