Pyrus communis (pear): 137716433 Help Entry 137716433         CDS       T10779                                  Name (RefSeq) calmodulin-like protein 11   KO K02183   calmodulin Organism pcox  Pyrus communis (pear) Pathway pcox04016   MAPK signaling pathway - plant pcox04070   Phosphatidylinositol signaling system pcox04075   Plant hormone signal transduction pcox04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:pcox00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     137716433    04070 Phosphatidylinositol signaling system     137716433    04075 Plant hormone signal transduction     137716433  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     137716433  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pcox01009]     137716433   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcox04131]     137716433    03036 Chromosome and associated proteins [BR:pcox03036]     137716433   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcox04147]     137716433 Protein phosphatases and associated proteins [BR:pcox01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      137716433 Membrane trafficking [BR:pcox04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     137716433 Chromosome and associated proteins [BR:pcox03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      137716433 Exosome [BR:pcox04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    137716433 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 EF-hand_FSTL1 SPARC_Ca_bdg EF-hand_EFHB_C SAPC2_N EH EF_EFCAB10_C RNA_pol_Rpb4 EF-hand_STIM1 EF-hand_11 PA_Ig-like Dockerin_1 SPEF2_C Caleosin Phage_TAC_12 EF-hand_SWAP70_N DUF5580_M DUF7674 DUF5580 SurA_N_3 DUF5343 MinC_N_1 Motif Other DBs NCBI-GeneID:  137716433 NCBI-ProteinID:  XP_068311993 LinkDB All DBs Position 14:22850970..22852261 Genome browser AA seq 148 aa AA seqDB search MADALTEGQISEFQEAFCLIDKDSDGLIRLEELATVIQSLDQRPTKEEIQDMISEIGADG NGTIDFEEFLNIMSRKMKENVAEELKEAFKVFDRDQDGYISASELRQVMINLGERLTDEE AEQMIKEADLDGDGLVSYEEFARMMMLS NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcagatgcattgacagaaggtcaaatttctgagttccaggaagccttttgcctcatt gacaaggattcagatggacttattagattggaagaactagcaacagtgatccagtcactg gatcaacgtcctacaaaagaagaaatccaagacatgataagtgagattggtgctgatgga aatgggaccatagattttgaagagtttttgaatattatgtcaagaaagatgaaggaaaat gttgctgaggagctcaaagaagccttcaaagtatttgacagagaccaagatggctacatt tcagcctctgagctgagacaagtgatgataaatttaggagaaagactgactgacgaagag gcagaacaaatgattaaagaagctgatttagatggtgatggtctagttagctatgaagaa tttgcaaggatgatgatgctcagttga

DBGET integrated database retrieval system