KEGG   Penicillium rubens: Pc21g21380
Entry
Pc21g21380        CDS       T01091                                 

Gene name
ips
Definition
(RefSeq) isopenicillin N synthase ips/PcbC-Penicillium chrysogenum
  KO
K04126  isopenicillin-N synthase [EC:1.21.3.1]
Organism
pcs  Penicillium rubens
Pathway
pcs00311  Penicillin and cephalosporin biosynthesis
pcs01100  Metabolic pathways
pcs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcs00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Pc21g21380 (ips)
Enzymes [BR:pcs01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.3  With oxygen as acceptor
    1.21.3.1  isopenicillin-N synthase
     Pc21g21380 (ips)
SSDB
Motif
Pfam: DIOX_N 2OG-FeII_Oxy
Other DBs
NCBI-GeneID: 8310374
NCBI-ProteinID: XP_002569113
UniProt: B6HLU0
LinkDB
Position
1
AA seq 331 aa
MASTPKANVPKIDVSPLFGDNMEEKMKVARAIDAASRDTGFFYAVNHGVDVKRLSNKTRE
FHFSITDEEKWDLAIRAYNKEHQDQIRAGYYLSIPEKKAVESFCYLNPNFKPDHPLIQSK
TPTHEVNVWPDEKKHPGFREFAEQYYWDVFGLSSALLRGYALALGKEEDFFSRHFKKEDA
LSSVVLIRYPYLNPYPPAAIKTAEDGTKLSFEWHEDVSLITVLYQSDVANLQVEMPQGYL
DIEADDNAYLVNCGSYMAHITNNYYPAPIHRVKWVNEERQSLPFFVNLGFNDTVQPWDPS
KEDGKTDQRPISYGDYLQNGLVSLINKNGQT
NT seq 996 nt   +upstreamnt  +downstreamnt
atggcttccacccccaaggccaatgtccccaagatcgacgtgtcgcccctgttcggcgac
aatatggaggagaagatgaaggttgcccgcgcgattgacgctgcctcgcgcgacaccggc
ttcttctacgcggtcaaccacggtgtggatgtgaagcgactctcgaacaagaccagggag
ttccacttttctatcacagacgaagagaagtgggacctcgcgattcgcgcctacaacaag
gagcaccaggaccagatccgtgccggatactacctgtccattccggagaaaaaggccgtg
gaatccttctgctacctgaaccccaacttcaagcccgaccaccctctcatccagtcgaag
actcccactcacgaggtcaacgtgtggccggacgagaagaagcatccgggcttccgcgag
ttcgccgagcaatactactgggatgtgttcgggctctcgtctgccttgctgcgaggctat
gctctggcgctgggcaaggaggaggacttctttagccgccacttcaagaaggaagacgcg
ctctcctcggttgttctgattcgttacccgtacctgaacccctacccacctgccgccatt
aagacggcggaggacggcaccaaattgagtttcgaatggcatgaggacgtgtcgctcatt
accgtcctgtaccagtcagacgtggcgaacctgcaggtggagatgccccagggttacctc
gatatcgaggcggacgacaacgcctacctggtcaattgcggcagctacatggcacacatc
accaacaactactaccccgctcccatccaccgggtcaagtgggtgaacgaggagcgccaa
tccctcccgttcttcgtcaatctgggatttaatgataccgtccagccgtgggatcctagc
aaggaagacggcaagaccgatcagcggccaatctcgtacggcgactatctgcagaacgga
ttagttagtctaatcaacaagaacggccagacatga

DBGET integrated database retrieval system