KEGG   Phascolarctos cinereus (koala): 110198970
Entry
110198970         CDS       T05867                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110198970 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pcw04050]
    110198970 (TNFRSF8)
   04090 CD molecules [BR:pcw04090]
    110198970 (TNFRSF8)
Cytokine receptors [BR:pcw04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   110198970 (TNFRSF8)
CD molecules [BR:pcw04090]
 Proteins
  110198970 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 CcmD
Other DBs
NCBI-GeneID: 110198970
NCBI-ProteinID: XP_020829285
UniProt: A0A6P5J4W8
LinkDB
Position
Unknown
AA seq 412 aa
MVTRCVALGLLLLGAVGALPQKQDLCEPGFYYNESSGSCCYLCLSDLVPQKPCPQGLEDC
REKCDPDYYLEIEEESRCQACVNCTRDDLVEKIPCTWNSPRVCECQEGMFCATSASYSCA
RCVKHSLCPPGTIVKEQGTLEEDTVCEPCLPGTFSNHSSSAQDCQPHTRISDIPDPSNTT
ADPSDGSSTHDIGTVSPSLTGRPNPGSESLFWVATVFAVTLAFVLFLICQQKACRKGILQ
KLHLHSGQAFQPKVMPTGYSPGNNCQQSRSLPRNAEISEKQGLMSGRPAVETNDHLTPFS
KEPLGLNLNATENLGPGDIPEPRATTEHTNNQIENIYIMKADTVIVGSVTRVSEGRNPVV
TLGLEETALETDQSTHYPEQETELSPGGHIEVMFSVEEEGKEYHWPTAVSAK
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggtcacccggtgcgttgcgctggggctgctgctccttggggcggtcggggccctccca
cagaaacaagacctgtgtgaacccggcttctactacaatgagtcttctgggagttgctgc
tacctctgcctctcagatctggtgcctcagaagccatgtccccaagggcttgaagactgc
agagagaagtgtgatccagactattacttggaaattgaggaggaatcccgctgccaggcc
tgtgttaactgcactagagatgaccttgtggagaagattccttgtacgtggaactcccct
cgggtttgtgaatgccaggaaggcatgttctgtgccacgtcagccagctacagctgtgcc
cgttgtgtgaagcactccctgtgcccaccagggaccatagtcaaagagcaaggcaccttg
gaggaggatactgtttgtgagccctgcctccctgggaccttttccaaccacagctccagt
gcccaggattgtcagcctcacaccaggatctctgatattccagacccttccaacaccaca
gctgacccctccgacgggagttcaacccatgacattgggactgtctcaccatctctcaca
ggaagacccaatccaggttctgagtctcttttctgggtggcgacggtctttgctgtgacg
cttgccttcgttctcttcctgatctgccagcagaaggcctgcaggaaggggattctgcag
aagcttcacctccattctggccaagccttccaacccaaggtcatgcctacgggttacagc
cccgggaataattgccaacagtctaggagtcttccaaggaatgccgagatctctgaaaag
caagggttaatgagtggtcgccctgctgtggagacaaacgaccacttgaccccattctcc
aaggagccccttggcctgaatctgaatgctactgagaatcttggccctggggacattcct
gagccccgggcgaccacggaacacactaataaccagattgagaatatctatatcatgaaa
gccgacacagtgattgttgggtctgtcactagagtgtccgagggcaggaaccccgttgtg
accttgggacttgaggagacggccctggagactgaccagtctacccattatccagagcag
gagacagagttgtcccctgggggccacatcgaagtcatgttctccgtggaggaggaaggg
aaggagtaccactggccaacagctgtgtctgccaagtga

DBGET integrated database retrieval system