KEGG   Phascolarctos cinereus (koala): 110220453
Entry
110220453         CDS       T05867                                 
Symbol
ITGAX
Name
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-X
  KO
K06462  integrin alpha X
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04610  Complement and coagulation cascades
pcw04810  Regulation of actin cytoskeleton
pcw05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110220453 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110220453 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110220453 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pcw04515]
    110220453 (ITGAX)
   04090 CD molecules [BR:pcw04090]
    110220453 (ITGAX)
Cell adhesion molecules [BR:pcw04515]
 Integrins
  Integrin alpha subunits
   110220453 (ITGAX)
CD molecules [BR:pcw04090]
 Proteins
  110220453 (ITGAX)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 Integrin_alpha
Other DBs
NCBI-GeneID: 110220453
NCBI-ProteinID: XP_020860116
UniProt: A0A6P5LVG6
LinkDB
Position
Unknown
AA seq 1167 aa
MTPIDLTAMDSAALVLLMALASSHGFNLDTDHPTTFQSDGAEFGHTVVLYEGSRLVVGAP
LERTSPNQTGQLYNCEYGIGSCELIPMQIPLEAVNMSLGLSLTAGRNPSQILACGPTVHQ
ACGMNTYMKGFCFVLSSNLQQRQKFPPALQECPKQDNDIAFLIDGSGSISGSDFQKMKNF
VKAVMSQFEKPKTQFSLMQFATRFWKHFTFDTFMKSRDPGELVDNIFQLHGVTKTATGIS
KVVNELFQKSSGAREDATKILIVITDGEKYEDSLEYRDVIPMADEAGIIRYAIGVGKAFD
DQKSKQELDEIASKPSKDHVFQVDNFEALNNIQNQLKEKIFAIEGTKSTDTISFQYEMSQ
EGFSAAFTSDGPVLGAMGTFDWSGGAFLYSQTGSAIFIKTSNIDKDVNDAYLGYSTEAFT
WNGAQSLVLGAPRYQHIGKVVIFVNGYRTWVQKAEVKGTQIGSYFGATLCPVDLNRDSNT
DLILIGAPHYYEQNHGGQVSVCSLPWQNAKWQCNSILKGQQGHPFGRFGAALAVLGDING
DKLTDVAVGAPGEEENHGAIYXFHGAVEYSINPSYTQKISGSLLSPTLQYFGQSLSGGQD
ITQDGLMDVAVGAQGQVLLFRTQPVLKVKASIQFMPVELARSVFECQAQEATNREAGSAT
VCLTISKSIQDRLGNVQSSVSYDLALDPGRLSPRAVFDETKSRTLKRVEILGLGNHCETV
KLLLPECVEDSVTPIILRLNFTLVGQPIPFSGNLRPVLAMGSPNHFTAALPFEKNCGDDH
ICKDDLSVTFSFSRLQTLVVGYFLELEIEVTVRNEGEDSYRTMVTFTYPPGLSYRRVSVA
QNSKHQQHSPHLACDIPAVSELENLRSSSCSINHPIFRMGSKVTFIMTFDVSPTANLGDQ
VLFKATVSSENNTPMTSKNVFQLKLPVKYAIYTVINSIEDSTKYLNFSVSEEKQVNTTEH
GYRINNLGQRALPVHIDFWVPVELNKESIWNLTEVIYPQDSSIQCAIERKEPSHSDFLTH
IHKSPVVNCSIAVCLRIGCDIPTFKIQEETDFLIKGNFSFGWVSQTQQKKLLFVSSAKIS
FDELKYSQLPGQEAFLRTQVETVVEQYEIYNPIPLILGSTVGGLLLLALITIGLYELGFF
KRHYKDMMEDKAQEADLKNEDSQAPTS
NT seq 3504 nt   +upstreamnt  +downstreamnt
atgactcccatagaccttacagccatggattctgctgcacttgtcctgctaatggctttg
gcctcttctcatggattcaacctggacacagaccatcctacaactttccagtcagatgga
gctgaatttgggcacactgtggtcctgtatgagggttcccgcctggtggtaggagccccc
ttggagaggacatcccctaaccaaacagggcaactctacaactgtgaatatggcattggg
agttgtgagctcatccccatgcagatccctctagaggcagtgaacatgtccctgggtctc
tctctgacggctggtagaaacccttcacagattctggcctgtggacctacagtacatcaa
gcctgcgggatgaacacttacatgaaaggtttctgctttgtgttgagttcaaatctgcag
caacgtcagaagttcccgccagctcttcaagagtgccccaaacaagataatgatattgct
ttcctgattgatggctccggcagcatttctggctctgacttccagaaaatgaaaaacttt
gtgaaggctgtgatgagccagtttgaaaagcctaaaacacagttttccctgatgcagttt
gcaaccagattctggaaacattttacctttgacacattcatgaagagtcgtgatcctgga
gagctggtggataatatttttcaactgcatggagtgacaaaaactgccacaggcatcagc
aaagtggtaaatgaactctttcagaaatcaagtggcgcacgagaagatgccactaagatc
ctcattgtcatcacagatggcgaaaaatatgaagactccctggaatacagagatgtcatc
cccatggcagatgaagcaggaataatccgatacgcaattggggtgggaaaagcctttgat
gatcagaagtccaaacaagaactagatgaaattgcatcaaaaccttccaaggatcatgta
ttccaggttgacaactttgaagcactcaataatattcaaaaccagctgaaagagaagatc
tttgccattgagggtaccaagtctacagatactatctccttccaatatgaaatgtctcag
gagggtttcagtgctgcatttacatctgatgggccagtccttggagccatggggaccttt
gactggtcaggtggtgccttcttgtactcccaaactggaagtgccatctttatcaagaca
tccaatatagataaggacgtgaatgacgcttacctgggttattctactgaggcattcact
tggaatggggctcaaagccttgttctgggagcccctcgataccagcacattgggaaggtc
gtgatctttgtgaatggttatagaacctgggtgcagaaggctgaggtcaaagggacacag
attggctcctattttggggcaacgctctgccctgtggatcttaacagagatagcaacact
gacctgatcctcattggagctccccattactatgagcagaatcatggaggccaggtgtcc
gtctgctcattaccttggcagaatgccaagtggcagtgtaacagtattcttaaaggacag
caaggacacccctttggacgttttggagcagccttggctgtgctaggggacataaatggg
gataagctaacagatgtggccgtgggggcaccaggggaggaagaaaaccatggagccatc
tatnnttttcatggagcagttgaatacagcatcaatccttcctacacccagaaaatcagt
ggctccctcctttcccccacactccaatattttgggcagtcactgagtggaggacaagac
atcacccaggatggcctcatggatgtagcagtgggagcccaaggacaggtattactgttc
aggacacagccagtgctgaaagttaaagcatccatccaatttatgccagtggaattggca
aggtctgtgtttgagtgccaggcacaggaagccaccaacagggaagcagggagtgccact
gtctgccttactatctccaaaagtattcaagacaggctaggtaatgtccaaagttctgtg
agttatgacctggccctggatcctggacgcctaagtcctcgtgctgtctttgatgagaca
aaaagccggacactaaagcgagttgaaatcctgggattggggaatcactgtgagactgtg
aagttgctgttaccagaatgcgtggaggactcagtgactcccatcattctgcgcctcaac
ttcactctggtgggacagcccatccctttttccgggaacctccgacctgttctagctatg
ggctctccgaatcacttcacagcagctctcccttttgaaaagaattgtggtgatgatcac
atctgtaaagatgatctcagtgtcactttcagcttctccaggctgcagaccttggtggtg
gggtacttccttgagctggagattgaagtgacagtgagaaatgagggtgaggactcttac
aggaccatggtcaccttcacatatcccccaggactgtcctatcgtcgagtgtcagtggcc
cagaactcaaagcatcagcagcattccccgcatctggcttgtgatataccagcagtctcc
gagttggagaatttgagaagcagcagctgtagcatcaaccacccaatcttccgaatgggg
tccaaggttactttcataatgacatttgatgtgtcccctacagccaaccttggagaccaa
gtacttttcaaagccactgtgagcagtgagaacaacacacctatgaccagtaaaaatgtc
ttccagctgaaactaccagtgaaatatgcgatctacacagtgatcaacagcattgaagat
tccaccaaatatcttaacttctcagtttcagaagagaagcaagttaacacgactgagcat
ggatacagaataaataacctgggacagagggctctacctgtccacatagacttctgggtt
cctgtggaattgaacaaggagtctatatggaatctgactgaggtcatttacccccaggat
tcatcaattcagtgtgccatagaaagaaaagaacccagtcactctgacttcttgacccac
atccacaagagcccagtggtgaattgctccattgctgtctgcttgagaattggctgtgat
atccccaccttcaaaatccaagaggagactgacttcctcattaaaggcaatttcagcttt
ggctgggtcagccagactcaacagaagaagctgttgtttgtgagttcagctaagattagt
tttgatgaattaaagtattcccagcttccaggacaagaggcctttttgagaacccaggta
gagacagtggtggaacagtatgagatctacaatcccattcccctcatcttgggcagcact
gtggggggactcctgctgctggcactcatcacaattgggctgtatgagcttggtttcttc
aaacgtcactataaggacatgatggaagataaagcccaggaggctgatctgaaaaatgaa
gactctcaagcccccacctcctga

DBGET integrated database retrieval system