Phascolarctos cinereus (koala): 110221290 Help Entry 110221290         CDS       T05867                                  Name (RefSeq) C-C motif chemokine 5-like   KO K12499   C-C motif chemokine 5 Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04060   Cytokine-cytokine receptor interaction pcw04061   Viral protein interaction with cytokine and cytokine receptor pcw04062   Chemokine signaling pathway pcw04620   Toll-like receptor signaling pathway pcw04621   NOD-like receptor signaling pathway pcw04623   Cytosolic DNA-sensing pathway pcw04668   TNF signaling pathway pcw05020   Prion disease pcw05142   Chagas disease pcw05163   Human cytomegalovirus infection pcw05164   Influenza A pcw05168   Herpes simplex virus 1 infection pcw05323   Rheumatoid arthritis pcw05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     110221290   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110221290    04061 Viral protein interaction with cytokine and cytokine receptor     110221290  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110221290    04621 NOD-like receptor signaling pathway     110221290    04623 Cytosolic DNA-sensing pathway     110221290    04062 Chemokine signaling pathway     110221290  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     110221290    05168 Herpes simplex virus 1 infection     110221290    05163 Human cytomegalovirus infection     110221290   09174 Infectious disease: parasitic    05142 Chagas disease     110221290   09163 Immune disease    05323 Rheumatoid arthritis     110221290   09164 Neurodegenerative disease    05020 Prion disease     110221290   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110221290  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110221290    00536 Glycosaminoglycan binding proteins [BR:pcw00536]     110221290 Cytokines and neuropeptides [BR:pcw04052]  Cytokines   Chemokines    110221290 Glycosaminoglycan binding proteins [BR:pcw00536]  Heparan sulfate / Heparin   Chemokines    110221290 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  110221290 NCBI-ProteinID:  XP_020861430 UniProt:  A0A6P5LS92 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MKVFAALPYIILVSGTLYSTTISSPYASDTTPCCFSFTTLPLPLNHIKEYFYTSSRCGNQ GVVFITRKNRQLCANPEKKWVRSYINSLEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaagtctttgctgcgctcccctacatcattcttgtcagtggcaccctctattctaca acaatctcctccccatatgcctcagacaccaccccctgctgtttctccttcactactcta ccgcttcccctgaaccatatcaaagaatacttctacaccagcagcagatgtggcaaccag ggtgtggtcttcatcacccggaaaaaccgtcagctctgtgccaaccctgagaagaaatgg gtacgcagttacatcaactccttggagatgagctag

DBGET integrated database retrieval system