KEGG   Pocillopora damicornis (lace coral): 113664366
Entry
113664366         CDS       T05773                                 

Definition
(RefSeq) translocon-associated protein subunit delta-like
  KO
K04571  translocon-associated protein subunit delta
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113664366
SSDB
Motif
Pfam: TRAP-delta DUF5927
Other DBs
NCBI-GeneID: 113664366
NCBI-ProteinID: XP_027035764
LinkDB
Position
Unknown
AA seq 189 aa
MPRDVLSSFSSSVDGTNMAALFFVLAVLAVSVPLKSSGDACVGARPTTDIYTTRNILLSS
ESVFIVEFSLKCDNGAKNVNLYAEVNGKVMPVTRSTDDAKYQVSWAEEHKEAKAGVYKLS
FYDDEGYAAYRKAQRSGTPSEAKALFSIDVNHRGAGREGLYVQTEFIAVVAALLIWWSAN
NVKSKLQES
NT seq 570 nt   +upstreamnt  +downstreamnt
atgccacgtgatgttcttagttcgttctcttcgagcgtggacgggaccaacatggctgcc
ctgttctttgttctcgccgttttagctgtttctgtgcctctaaagtcatctggtgatgct
tgcgtaggagctaggccaaccacagacatttataccacaaggaatattttgctgtcatca
gagagtgtgttcattgttgaattttccctcaaatgtgacaatggtgcaaagaatgtgaat
ctgtatgctgaagttaatggaaaagttatgccagttacaagatcgactgatgatgcaaaa
taccaggtcagctgggcagaggagcacaaggaggctaaagctggtgtctacaaattgagt
ttctatgatgatgagggatatgcagcctatagaaaggcacagagaagtggtacaccaagt
gaggccaaggccttgttctccattgatgtcaatcatcggggagctggccgtgaaggactc
tatgtacaaacagagtttattgccgttgtagcagctttgttgatttggtggagtgccaac
aatgttaaaagtaaactgcaggaatcctag

KEGG   Pocillopora damicornis (lace coral): 113672217
Entry
113672217         CDS       T05773                                 

Definition
(RefSeq) translocon-associated protein subunit gamma-like
  KO
K13251  translocon-associated protein subunit gamma
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113672217
SSDB
Motif
Pfam: TRAP-gamma ATG11 RIC3 DUF4131
Other DBs
NCBI-GeneID: 113672217
NCBI-ProteinID: XP_027044303
LinkDB
Position
Unknown
AA seq 182 aa
MAGGKKLTKEDEILLQNFSRTVSTKSSALFYANAFFVSAIPLWLFWRIHQMDPYSSGIMF
VVMTLASTWLVAFAYKNVKFQLKHKIAQRRDASVTKEVSMELDSNKKLTRQEKDERILWK
KNKVAETEAITFSIFYNNALYLFLVLIASFYVLRTFNPAANYLLSTSIAGGVLALLSTGS
SS
NT seq 549 nt   +upstreamnt  +downstreamnt
atggcgggcggcaagaaactcacaaaagaagacgaaattttgctgcaaaatttcagcaga
accgtttcaactaaatcttcagcattattctatgccaatgcattcttcgtctcagccatt
cctctctggttgttttggaggattcaccaaatggatccttattcatctggcatcatgttc
gtcgttatgactctcgccagtacgtggctagtggcttttgcctacaagaacgtgaagttt
cagttgaaacataagattgcccaacgaagagatgcctcagttaccaaagaagtcagcatg
gagctggattctaataagaagctgacccgccaagaaaaggatgaaagaatcctttggaaa
aagaacaaggttgctgaaactgaagccattaccttctccatattttacaacaatgccttg
tacctgtttttggtcctgatagcttcattttatgttctgcggacatttaatcctgctgca
aactacctactctccacatccatagctggtggtgtccttgctctgctgtctactggatca
tcctcctaa

KEGG   Pocillopora damicornis (lace coral): 113675762
Entry
113675762         CDS       T05773                                 

Definition
(RefSeq) translocon-associated protein subunit alpha-like
  KO
K13249  translocon-associated protein subunit alpha
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113675762
SSDB
Motif
Pfam: TRAP_alpha SpoIIIAH Spore_coat_CotO DREPP SDA1 Presenilin
Other DBs
NCBI-GeneID: 113675762
NCBI-ProteinID: XP_027048170
LinkDB
Position
Unknown
AA seq 322 aa
MFSLLRKLLFLFFLILPASLVLIGNDVCVMAREDEVENEQEVAQPTEADATEATVDEEYV
EEVVEDADDGKVDAEDEEEDDKEDSPAPADSKTDAESTEEEEEKEETLKPSPDADTVIFF
TKPGNQVFPAGEVIKCLIGLGNNGKNDFIVEHAEASLRYPQDYTYYIQNFTGFQYNIVVQ
PGNQASFEYAFKPHESFGGRPFGLTVNLVYKDSEGKPFMDAVFNETITITESDEGIDGET
FFLYVFLAAIALLLVLAGHYALTSVKGKKPASKPVIEMGTQQNADIDYDWLPKETTTEFV
GKNSPRRSPRNRRQKRNTGSDE
NT seq 969 nt   +upstreamnt  +downstreamnt
atgttctctttactacggaaacttctctttcttttttttttaattttaccggcatcgcta
gttctgattggaaatgatgtatgtgttatggcccgggaagacgaagttgaaaacgaacaa
gaggtcgcacaaccaaccgaagcagacgctacagaggctacagtagatgaggaatatgtt
gaagaagttgttgaagatgcggatgatggaaaggtggatgctgaagatgaagaagaagat
gacaaggaagacagtccagctccagcagactctaaaactgatgcagagtctactgaggaa
gaagaggaaaaggaagaaactctcaagccatctcctgatgctgatacagttattttcttc
accaagcctggaaaccaagtatttccagctggggaagtaatcaagtgtctcattggcctt
ggtaataatggcaagaatgattttattgtggaacatgcggaagcttctctcaggtatcct
caagattacacctattacatccaaaacttcactggtttccaatataacattgttgtacaa
ccaggcaatcaggcatcctttgaatatgcatttaaacctcatgaatcatttggcgggcgt
ccatttggtttaactgttaacttggtctacaaggactcggaaggtaaaccattcatggat
gcagtcttcaatgaaactatcaccataacagaaagcgatgaaggaattgatggtgaaacc
ttcttcctgtatgtgttcttggcagcaatagctctgctgttagttttagctggtcactat
gctctcacgtcagtcaagggaaagaaaccagcctccaagcctgtaattgagatgggtaca
caacagaatgctgatattgactatgactggctccccaaagaaacaaccacagagtttgtt
ggcaaaaattctcctcgccgttctccaagaaacagacgtcagaagcgcaacacaggctct
gatgaatag

KEGG   Pocillopora damicornis (lace coral): 113683459
Entry
113683459         CDS       T05773                                 

Definition
(RefSeq) translocon-associated protein subunit beta-like
  KO
K13250  translocon-associated protein subunit beta
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113683459
SSDB
Motif
Pfam: TRAP_beta BatD CARDB Cupredoxin_1 PROL5-SMR
Other DBs
NCBI-GeneID: 113683459
NCBI-ProteinID: XP_027056499
LinkDB
Position
Unknown
AA seq 189 aa
MKPLCLCLLIGALIGCALSAEGDSSARLLISKNILNQFVVEGKELTVHYSIYNVGNGPAT
SVSLSDNSFPADEFKVLHGLLSVKWKTIAPGSNVSHTIILEPLKSGTFNFTAAQVTYKAS
EDATDPQIAFSTAPGEGGIMPQNEYDRKHSPHLVDWGLFSLMSLPTILIPFLVWFRSHSK
YENFKAKKN
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaaaccactgtgtttgtgtctccttattggagcattgataggctgtgcattaagtgct
gaaggtgattctagtgccagacttcttatctccaaaaatattctcaaccaatttgttgtt
gaaggaaaggaattgacagtgcactacagcatctacaatgttggaaatgggcctgccaca
tcagtgtccttgtcagataattctttcccagctgatgagtttaaggttctccatggatta
ctttcggtcaagtggaaaaccattgcacctggttcaaatgtatcacacactatcatcctg
gaacccttaaagtctggtacattcaacttcactgcagcacaggtaacctacaaagcttct
gaagatgccacagatcctcagattgctttttctacagccccaggagaaggaggaattatg
ccccaaaatgaatatgaccgtaaacattctccacatctggtggactggggtctttttagc
ctgatgtctttacccaccattctaataccgtttcttgtctggtttcgaagccactcaaag
tatgaaaacttcaaggcaaagaagaactaa

DBGET integrated database retrieval system