KEGG   Pocillopora damicornis (lace coral): 113664571
Entry
113664571         CDS       T05773                                 

Definition
(RefSeq) transitional endoplasmic reticulum ATPase
  KO
K13525  transitional endoplasmic reticulum ATPase
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113664571
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdam03019]
    113664571
   03009 Ribosome biogenesis [BR:pdam03009]
    113664571
   04131 Membrane trafficking [BR:pdam04131]
    113664571
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdam04147]
    113664571
Messenger RNA biogenesis [BR:pdam03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     113664571
Ribosome biogenesis [BR:pdam03009]
 Eukaryotic type
  Pre-60S particles
   Ribosome quality control complex
    113664571
Membrane trafficking [BR:pdam04131]
 SNARE
  SNARE associated proteins
   Others
    113664571
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    113664571
Exosome [BR:pdam04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113664571
SSDB
Motif
Pfam: AAA AAA_lid_3 CDC48_N RuvB_N AAA_16 AAA_2 AAA_5 AAA_33 AAA_22 CDC48_2 TIP49 AAA_18 RNA_helicase AAA_14 Mg_chelatase ATPase IstB_IS21 AAA_7 AAA_28 Parvo_NS1 Vps4_C ATPase_2 AAA_17 ABC_tran Bac_DnaA AAA_24 Viral_helicase1 TsaE Sigma54_activat DUF815 NACHT Zeta_toxin NB-ARC ResIII Rad17
Other DBs
NCBI-GeneID: 113664571
NCBI-ProteinID: XP_027035993
LinkDB
Position
Unknown
AA seq 808 aa
MAHQDELATAILKNKSKPNRLLVEEAINDDNSVVSMSQAKMEELQLFRGDTVLIKGKKRR
DTVCIVLSDDTISDDKIRMNRVVRRNLRVRLGDIVSVQACPDVKYGKRIHVLPFDDTVEG
LTGNLFDVFLKPYFLEAYRPIRKEDMFLVRGGMRAVEFKVIETDPSPYCIVAPDTVIHCE
GEPVKREEEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFRAIGVKPPRGILLYG
PPGTGKTLMARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDE
IDAIAPKRDKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSVDPALRRFGRFDR
EVDIGIPDATGRLEILRIHTKNMKLGDDVDLEQIAAETHGYVGSDVASLCSEAALQQIRE
KMDLIDLEDEQIDAEVLDSLAVSMDNFRYAMGVSNPSALRETVVEVPTTTWDDIGGLDTV
KRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGP
ELLTMWFGESEANVRDVFDKARSAAPCVLFFDELDSIAKARGGNVGDGGGAADRVINQVL
TEMDGMNVKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEASRVSILSACLRKSP
IAKDVDLNYIAKVTHGFSGADLTEICQRACKLAVRESIETEIRLERERADNPDLDMEVED
EDPVPEITRSHVEEAMKFARRSVSDNDIRKYEMFAQTLQQSRGFGGNFRFPNQSGGGSQG
GGQGGGQGGSGGADDSNLYDDGDDDLYS
NT seq 2427 nt   +upstreamnt  +downstreamnt
atggctcatcaggacgaactcgcgacggctattttaaagaacaagtcgaagcctaaccgt
ttattggtggaagaagctattaatgatgacaattcagttgtatctatgtctcaggcaaaa
atggaagagctgcagctctttcgtggagatacagtcctgataaaaggaaagaagagacgg
gatactgtatgtattgtgctgtcggatgatactatctctgatgacaagataaggatgaat
cgtgttgtaaggaggaatctgcgagtgaggcttggtgatatagtcagtgtacaagcatgt
cctgatgtcaaatatggcaaacgaattcatgtcctgccatttgatgatacagtggaaggc
ctaactgggaacctgtttgatgtgttcttaaagccatactttttggaagcatacagacct
atcaggaaagaggacatgtttcttgtacgtggtggaatgagagctgttgaattcaaggtc
atagagactgatccaagtccatactgcattgtagcaccagacacagtaattcattgtgaa
ggagagccagttaagagagaggaagaggaggagtctctaaatgaagttggttatgatgac
attggaggctgtaggaaacagttggcccaaataaaggagatggtggagttacctctcaga
catccccagttgtttcgggccattggtgtgaagcctccccgtggtattcttctctatggt
cctccaggaactggaaaaactttgatggcaagagctgttgcaaatgagacaggagcattt
ttcttcttgatcaatggtcctgagataatgagtaaacttgctggtgaatctgaaagcaat
ctaaggaaagcttttgaagaggcagaaaaaaattccccagcaatcatattcattgatgaa
attgatgctattgctcctaagagagataagacacatggagaagtagagcggcgaattgtg
tcccaactgttgactctgatggatggtttaaagcagaggtcccatgttatcgttatggca
gcaactaacagaccaaacagcgttgacccagctctgcgaagatttggccgttttgatagg
gaggtggacattggcataccagatgctacaggccgtttagagattttacgtattcataca
aagaacatgaaacttggagatgatgttgatcttgagcagattgcagctgaaactcatggt
tatgttggttcagatgtggcctctctctgttcagaagctgctcttcaacagattcgtgaa
aaaatggatttaattgacttggaagatgaacaaattgatgcagaggtactggactctcta
gctgtttccatggataatttcaggtatgccatgggtgtatctaacccatcagctctccgt
gagactgtggttgaggtgcctacaactacatgggacgatattggtggtttagacactgtc
aaacgtgaactacaggagcttgtacagtacccagtggaacacccagataagttccttaag
tttggaatgacaccttccaaaggagtactgttctacggtccaccaggttgtggtaagacc
ctattggctaaagccattgcaaatgaatgccaagcaaacttcatttcaatcaaaggtcca
gagcttcttactatgtggtttggtgagtccgaggccaatgtgcgagatgtatttgacaag
gcccgaagtgctgctccttgtgtgcttttctttgatgaattagattccattgctaaagca
aggggaggcaatgttggagatggaggaggagcagcagatcgtgtgatcaaccaggtacta
actgaaatggatggcatgaatgtcaagaagaatgtcttcattattggagcaaccaacagg
ccagacatcattgatccagccatactgcggccaggtcgtttggatcagctgatttacatt
cctcttcctgatgaagcatcacgtgtctccatactctcagcatgtttgaggaaatctcca
attgcaaaggatgtagacttgaattatattgcaaaggttactcatggctttagtggtgca
gatttaacagagatctgtcaaagggcatgcaagctagctgtcagggagtcaatagagaca
gagataaggttggaaagggagcgagctgacaacccagacttggacatggaagtggaagat
gaagatcctgtaccagagatcacaagaagccatgttgaagaggcaatgaaatttgcccgc
agatctgtcagtgataatgatattcgcaaatatgagatgtttgctcaaactttgcagcag
agccgtggatttggtggaaactttagattcccaaatcagtcaggaggtggatctcagggg
ggtggacaaggaggtggacaaggtggctcaggaggagcagatgattctaacttatatgat
gatggagatgatgacctgtacagttaa

DBGET integrated database retrieval system