KEGG   Pocillopora damicornis (lace coral): 113664625
Entry
113664625         CDS       T05773                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase CHIP-like
  KO
K09561  STIP1 homology and U-box containing protein 1 [EC:2.3.2.27]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04120  Ubiquitin mediated proteolysis
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113664625
   04120 Ubiquitin mediated proteolysis
    113664625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pdam03110]
    113664625
   04131 Membrane trafficking [BR:pdam04131]
    113664625
   04121 Ubiquitin system [BR:pdam04121]
    113664625
Enzymes [BR:pdam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     113664625
Chaperones and folding catalysts [BR:pdam03110]
 Other chaperones and cochaperones
  Others
   113664625
Membrane trafficking [BR:pdam04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    113664625
Ubiquitin system [BR:pdam04121]
 Ubiquitin ligases (E3)
  U-box type E3
   113664625
SSDB
Motif
Pfam: U-box CHIP_TPR_N TPR_1 TPR_2 TPR_16 TPR_11 ANAPC3 TPR_7 TPR_8 TPR_12 TPR_14 TPR_17 zf-NOSIP TPR_19 TPR_9 TPR_10
Other DBs
NCBI-GeneID: 113664625
NCBI-ProteinID: XP_027036051
LinkDB
Position
Unknown
AA seq 273 aa
MTAIDLKEQGNRLFSGRHYDDAAQCYTKAIIKNPTVPTYFTNRALCHLKLKKWSQVISDC
RRAIELDVNLVKAHFFLGQALLEQENYDEALASLKRAYDLAKEQKLNFGDDIASTVRLAK
KKRFSVAEERRISQEIELQSYLNNLILDDKKRQIKAAGKDPDKEELDKIELECDKRLSEV
NSLFKEVDVRRKKREVPDFLCGQISFELMKDPVITPSGITYDRKHIEEHLQRVGHFDPVT
RTDLKQEQLTPNLVMKEVIDAFITENEWVVEEF
NT seq 822 nt   +upstreamnt  +downstreamnt
atgacggccatagacctcaaagaacagggaaatcgtctttttagcggcaggcattacgat
gatgcagcgcaatgttacacaaaggctattatcaagaatccaacagttccaacatacttc
acaaatcgggctttgtgtcatctcaaacttaagaagtggtctcaggtcataagtgactgt
cgtcgtgccatagaacttgatgtgaacctggtcaaggcacatttcttccttgggcaggca
ctccttgaacaggagaattatgatgaagcacttgcaagtttaaaaagagcctatgattta
gccaaagaacagaaacttaactttggagatgatatagcaagtacagtccgtctggctaaa
aagaagagatttagtgttgcagaagaaagacgaattagccaggaaatagagctccagtca
tatttgaataatctaatccttgatgataagaagagacaaattaaagctgcaggaaaagat
cctgataaagaagaacttgataaaattgaattggaatgtgataaaagactatcagaagta
aatagcctttttaaagaagttgatgtcagacgaaagaaaagagaggtgccagacttcttg
tgtggacaaattagttttgaactcatgaaggatccagtcattacaccaagtggaatcaca
tacgatcgtaaacacattgaagaacatttgcagcgtgttggccattttgatcccgtgaca
agaacggatttgaaacaagaacaattgactccaaacctcgttatgaaagaggtcatagat
gcgtttatcacagaaaacgaatgggtagtggaagaattctaa

DBGET integrated database retrieval system