KEGG   Pocillopora damicornis (lace coral): 113665949
Entry
113665949         CDS       T05773                                 

Definition
(RefSeq) ataxin-3-like
  KO
K11863  Ataxin-3 [EC:3.4.22.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113665949
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pdam01002]
    113665949
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pdam04121]
    113665949
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     113665949
Peptidases and inhibitors [BR:pdam01002]
 Cysteine peptidases
  Family C86
   113665949
Ubiquitin system [BR:pdam04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    113665949
SSDB
Motif
Pfam: Josephin UIM
Other DBs
NCBI-GeneID: 113665949
NCBI-ProteinID: XP_027037492
LinkDB
Position
Unknown
AA seq 293 aa
MDAIFHEKQEGSLCAQHCLNALLQGPYLNPVVLADIATQLDELERARMAEGDVTSQDYQE
FIKQPSSNMDDSGFFSIQVICNALRVWGLELIPFLSPEAREARENPQYQKAFICNLQQHW
LTIRKIGHQWFNLNSLLSKPALITETYLSLFLTQLQTEGYSIFVVRGNLPESEADQLLKL
CPAESQKKPFTTSAHKLVDKTDLTAALQQASGVVGGDDKPVDMDAVRRKRELYFQRQNHT
QANNPNTEQTSETADTSQETVTTPGPPADQEESSELSEEEMLQIALKLSLEIT
NT seq 882 nt   +upstreamnt  +downstreamnt
atggatgcaatctttcacgagaagcaagaaggttctctttgcgcccaacactgcctcaat
gccttattacaaggcccttacttaaacccagtggttctggcggatatagcgacacaattg
gatgagcttgagagagcaagaatggcagaaggagatgttacatcacaggattatcaagaa
tttattaagcaaccttcttcaaatatggatgacagtggattcttctccattcaagttata
tgcaatgcactcagagtgtgggggttagagctgataccatttttgagtccagaggccaga
gaggcacgagaaaatcctcagtaccagaaagcttttatatgtaacttacaacaacattgg
ctgactatacgaaaaattggccatcagtggtttaatcttaactctctgttgtccaaacca
gcgctgataactgagacatatttgtcactatttcttacccaattacagacagaaggttat
tcaatatttgttgtgagaggaaatttaccagagagtgaagcagatcaacttttgaagctt
tgtccagctgagtcacagaagaaaccttttacaacgtctgcacacaaattggtggacaaa
acagatctaacagctgcgcttcaacaggccagtggtgttgtaggaggtgatgataaacca
gttgacatggacgcagttcggagaaaacgagaattgtattttcaaagacaaaaccacacc
caagccaacaatccaaatacagaacaaacctcagagacagcagatacatctcaagaaact
gtaacaacacctggtccaccagctgatcaagaagaatcgtcagaattatcagaggaggaa
atgcttcaaattgctctcaagttatctcttgaaattacatag

DBGET integrated database retrieval system