KEGG   Pocillopora damicornis (lace coral): 113666761
Entry
113666761         CDS       T05773                                 

Definition
(RefSeq) dnaJ homolog subfamily B member 11-like
  KO
K09517  DnaJ homolog subfamily B member 11
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113666761
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pdam03110]
    113666761
Chaperones and folding catalysts [BR:pdam03110]
 Heat shock proteins
  HSP40 / DNAJ
   113666761
SSDB
Motif
Pfam: DnaJ_C DnaJ
Other DBs
NCBI-GeneID: 113666761
NCBI-ProteinID: XP_027038350
LinkDB
Position
Unknown
AA seq 357 aa
MADLHVYFISALVLSCCIQILAGRDFYAILGVSRDASKNQIKRAYRKLAMKWHPDKNKED
PKAQERFQDLSSAYEVLADDEKRKVYDRHGEEGLKNMQQGGGDGFDPFSSFFGGFGFHFE
GSQRGAEREVPRGSDIHMDLHVTLEELYSGNFVEVLRIKPVTQTVPGTRKCNCRQEMRTT
QLGPGRFQMSPVDICDECPAVTYVTKEKLLEVEVEPGMRDGQEYPFVAEGEPHIDGEPGD
LKFIIREQRHDRFQRKGDDLYTNVTVALIDALNGFEMDIDHLDGHKVHIVREKITWPGAR
IKKKEEGMPNYENNHEKGDLFITFDVEFPRGGMSESEKEALKTILKQQSQQKVYNGL
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggcggacttacacgtgtattttatttcagccctcgttttatcttgctgcatacaaatt
ttagcagggcgggatttttatgcaatcttgggcgtctcgagagatgcaagcaagaatcaa
atcaagcgggcatacagaaaactggcgatgaagtggcatcccgataaaaacaaggaggac
cctaaagcacaagaaagatttcaggatctgagtagtgcatacgaggtcctagctgatgat
gagaagaggaaggtttatgacaggcatggagaggaagggctgaaaaatatgcaacaagga
ggtggtgatggttttgatcctttttcaagtttctttggagggtttggttttcattttgaa
ggatcacaacgtggggctgaaagggaagtccctcgtggaagtgatattcacatggatctt
catgtcacattagaagaactctactctggaaactttgtagaggttttacgcatcaaacca
gtcacacagacagttcctggcacaagaaagtgcaattgtcggcaagagatgagaacaaca
cagttgggtcctggaaggtttcagatgtcaccagtggatatctgtgatgagtgtcctgct
gtaacttatgtcactaaagaaaaacttttagaagttgaagtggaacctggaatgagagac
ggacaagaatatccttttgttgcagagggtgagcctcacattgatggtgaacctggtgat
ttgaagtttatcataagagaacaaaggcatgatagatttcagagaaaaggagatgatctt
tacacaaatgtgactgttgctttaattgatgcattaaatggatttgaaatggatattgac
catctggatggtcacaaggtgcacattgtgcgggagaaaatcacatggccaggagcacgc
ataaaaaagaaagaagaaggcatgcctaactatgaaaacaatcatgagaaaggagatctt
tttataacatttgatgttgaatttccaagaggtggcatgtcagaaagtgaaaaagaagct
ttgaagaccatcttgaagcaacaatctcaacagaaagtttataatggactctaa

KEGG   Pocillopora damicornis (lace coral): 113666776
Entry
113666776         CDS       T05773                                 

Definition
(RefSeq) dnaJ homolog subfamily C member 10-like
  KO
K09530  DnaJ homolog subfamily C member 10 [EC:1.8.4.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113666776
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pdam03110]
    113666776
   04131 Membrane trafficking [BR:pdam04131]
    113666776
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     113666776
Chaperones and folding catalysts [BR:pdam03110]
 Heat shock proteins
  HSP40 / DNAJ
   113666776
Membrane trafficking [BR:pdam04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    113666776
SSDB
Motif
Pfam: Thioredoxin DnaJ Thioredoxin_6 Thioredoxin_2 OST3_OST6 Thioredoxin_8 AhpC-TSA Redoxin Thioredoxin_7 Arrestin_N
Other DBs
NCBI-GeneID: 113666776
NCBI-ProteinID: XP_027038366
LinkDB
Position
Unknown
AA seq 805 aa
MNSPVLFILFSSFLYCPVLSEDYYELLGIDRDASHKDIRKAFKKLALKLHPDKNKDDPKA
HDKFTVINKAYEVLKDEELRKKYDLYGEEGLKDDHFGGGHYQSWNYFNEEFGIYDDDPEI
ITLSHSDFEVSVDGSEDIWFINFYSPFCSHCHDLAPTWREVARELEGVIRFGAVNCQEEW
NLCRRQGIPSYPSLVLYPTHEFHRGPRNTEALVKFILDNLEVNLFDLWEGNFEKQINKGN
EPWLIDFCVAGGDCLDSDTRIKLSAILDNLVNIGTIDCEASSQLCKDVGYSDDLVYFKGD
VEPGKGEVIDSLDAHEIVSMILKKLPDPVNIDLKKFEELREELSSTTDLPWVLHFDRGPM
NSMEIRKLPAFTSDINVGHVDCSKEVEICRRVHIRKFPMVALFKIHGYYEWHHGRFTAHD
IAVFAKESASSSVQTLGPEDFPAKITKPNHPFFVDFFAPWCPPCMRLLPEYRKAARSFED
HEVGFGTVDCTIHSNLCHMYNIRSYPTTILYNNSLPHQFTGHHTAADLVEFIENTMKPSV
VQLTPETFKLLVGERKNGETWLVDFYAPWCGPCNELAPDWNKLAKQMQGEAGVGSVDCQK
YRSFCQEQGVNSYPTIRLYPHYSQGSRTYVGHRGWRDVDSLYSWAFKYLPSLVTQLNYQA
FMDNVVDSEDPWIIDFYAPWCGHCIQFAPHYEKVAKLLEGHVKTGKVDCEQEYHLCSEAD
VRAYPTVKLYLGSPGSGMNQPVNGHMNIDSQNPNEIRDIVLQAVEEYKADLEDEKRKKTT
TKTKTKTKTKKKSKKKKNTPVHDEF
NT seq 2418 nt   +upstreamnt  +downstreamnt
atgaactcgccggtattatttatcttattttccagttttctttactgtccagtactctcc
gaagattattatgaattattaggaatagacagagacgctagtcataaggacattcggaaa
gcgttcaaaaagttagccctaaaactgcatcctgacaaaaataaggatgatccaaaggca
cacgacaagtttactgtgataaacaaggcttacgaagttttaaaagatgaagaacttcgg
aaaaaatatgatttatatggggaagaggggttgaaagatgaccactttggcggaggacat
taccagagttggaattattttaatgaagaatttggtatttatgatgatgacccagagatt
atcactttaagccattcagattttgaggtgtcagttgatggaagtgaagacatatggttt
atcaacttttattcacctttctgttcacactgccatgatttagcaccaacatggagagaa
gttgctcgggaacttgaaggagtgatcagatttggtgctgtcaactgccaggaagaatgg
aatttgtgtcgacgacaagggatccctagctacccctcccttgtgctttatcctacacat
gaattccatcgtggtccaagaaatacagaagcccttgttaagtttatactggataatctg
gaagttaacctttttgatttatgggaaggtaactttgagaagcagataaacaaaggcaat
gaaccttggttgattgacttttgtgttgctggaggagactgccttgactcagataccaga
attaaactttctgctattctggataatttggtgaatattggtactattgattgtgaagca
agttcccagctgtgtaaagatgttggctacagtgatgacttggtgtattttaaaggagat
gttgaaccaggaaaaggagaggttattgacagtttagatgcccatgaaattgtcagtatg
attttaaagaagcttcctgatcctgttaatatagacttgaagaaatttgaggaacttagg
gaagaactctccagtactactgatcttccttgggtgctgcattttgacagagggccaatg
aacagcatggaaataagaaagctgccagcatttacttcagatattaacgttggtcatgtt
gattgtagtaaagaagtagagatatgtcggcgagttcatatcagaaagttccccatggtg
gccctgttcaaaatacatggatactatgagtggcatcatggtcgcttcactgcacatgat
attgctgtttttgccaaagagagtgcttcttccagcgtgcagaccttaggacctgaagac
ttcccggctaaaatcactaaacctaatcatccatttttcgttgatttctttgctccatgg
tgtccgccttgcatgcgtcttttgcctgaatacagaaaagcagctcgatcatttgaagat
cacgaagttggtttcggtaccgtggactgtactattcattctaacttatgtcatatgtat
aacatacgctcctatccaacgacgatattatacaataacagccttcctcatcaatttacg
ggccaccacacagcagctgatttggtggagtttatcgagaacaccatgaaaccttcggtt
gtacagctgacgcctgaaacatttaaattactggttggggaaaggaagaacggtgaaaca
tggctggtagatttttatgcaccctggtgtggaccgtgtaatgaactggctcctgactgg
aacaagcttgccaagcaaatgcaaggagaggctggtgttgggtcagtggactgtcaaaag
tatcgatccttttgccaagagcaaggagtgaattcataccccaccattcgtctttatcct
cactattctcaaggatcccgtacctacgtgggccatcgcggctggcgggatgtagattct
ctatacagctgggcattcaaataccttccttcgcttgtaacgcagctgaattatcaggca
ttcatggacaatgttgtcgacagtgaggatccttggatcatcgatttctacgccccttgg
tgtggccactgcatacaatttgctccccattacgaaaaagtggcaaagttgttagaggga
cacgtcaaaactggcaaagtggattgtgaacaggagtaccatctgtgctcagaagctgat
gtgcgagcatacccaactgtcaagttataccttgggtcaccaggatctggaatgaatcag
ccagtaaatggacacatgaacatagactctcaaaacccgaatgagatacgggacattgta
cttcaagctgtggaggaatacaaggctgacttggaagacgaaaaaagaaaaaagacaacg
acaaagacaaagacaaagacaaagacaaaaaagaagagcaagaagaagaaaaatactccg
gtgcatgatgaattttag

KEGG   Pocillopora damicornis (lace coral): 113672519
Entry
113672519         CDS       T05773                                 

Definition
(RefSeq) dnaJ homolog subfamily C member 1-like
  KO
K09521  DnaJ homolog subfamily C member 1
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113672519
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pdam03110]
    113672519
Chaperones and folding catalysts [BR:pdam03110]
 Heat shock proteins
  HSP40 / DNAJ
   113672519
SSDB
Motif
Pfam: DnaJ Myb_DNA-binding Myb_DNA-bind_6 MADF_DNA_bdg
Other DBs
NCBI-GeneID: 113672519
NCBI-ProteinID: XP_027044611
LinkDB
Position
Unknown
AA seq 518 aa
MAALFDGLMLRIIFLMFFIFSRCSIVYGWDSVDLELFDLVEEIKDNFYDILGLKQDASQA
DIRRAYRKLSLQLHPDKNKEPDAEVKFRQLVAVSEVLKDEEKRKRYDGILRDGLPDWRQP
VFYYRSVRKMGLIEFTILLFLILTIGHYIVAWSIYLEKKLELEELLFSKKKREDKKRNKK
LKSKLNDEDIPDLADIMVQEVGVSKPTLRDLLPFKMTLWLIGFCTSLPEQYRAMVECLEK
RRMEKIEEEDEDDDDDDELEEKPSRPRRRQRVNIPQEDTEDNSWEGAPVTNVLKMATDNG
DHSAVTEKSGEWTDHEQSLLTRAMVKFPGGTPNRWEKIAVEIGRSVEEVTKQMKKLKQSY
GAPTHSSNAGEGDLSTLVINKKKAMVSDECLEQADECYNFGSNSNRHRNKSSRSQQTTKN
VADRPVSEVSVPSVLRDRTSEQSDGVTKKNVTDDDSTAWSQNQQKQLEIALQKFPKTVAD
RWTCIAQAVPGKTKEECILRYKFLVECVRKKKLAGQQQ
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggcggctctttttgatggactgatgttaagaataatttttcttatgtttttcatattt
tcgagatgttcgatcgtttacggctgggattctgtagatttagagttattcgaccttgta
gaagaaatcaaagataatttttatgacatacttgggctaaaacaggatgcaagccaggca
gacatcagaagggcatatcgtaaactgtctcttcagttgcaccctgataagaacaaagaa
cctgacgctgaggttaaattcaggcagcttgttgcagtatcagaggttctgaaagatgaa
gagaaaagaaaaagatatgatggcattctgcgtgatggcctgccagattggcgacagcct
gtattttactacaggagtgtgcgcaaaatgggacttattgaattcacaatccttctcttt
ttgatattaaccattggacactacattgtggcttggtctatttatttggagaaaaaactt
gaattggaagagctcctattttccaagaaaaaacgcgaggacaagaaacggaacaaaaag
ttgaaatccaaactgaatgatgaagacattcctgatcttgcagacataatggtacaagag
gttggtgtgtcaaaacccacactacgcgacctgctgccattcaaaatgacgctctggctg
attgggttctgtacgtcactgcctgagcaatatcgggctatggtggaatgcttggaaaaa
agaaggatggaaaagattgaggaagaggatgaagatgacgatgatgatgatgaattggaa
gaaaaaccatcaagaccacgaaggagacagagagtaaacattccacaggaagatacagaa
gataacagctgggagggtgctcctgtcaccaatgtgttaaagatggccacagataacggc
gaccattctgctgtaacagagaagtcaggtgaatggacagatcacgaacaatcccttctt
acccgtgctatggtgaaatttcccggggggacaccgaaccgttgggaaaaaattgctgta
gagattgggagatcagtagaagaggttacaaaacaaatgaaaaagttaaaacaatcctat
ggagcacctactcattcatcgaacgcaggtgaaggtgacttaagtacgctagtaataaac
aagaaaaaggcaatggtgagcgatgaatgcctggagcaagctgacgaatgctacaacttt
ggaagcaactcaaatcgtcaccgtaacaaatcgtcgagaagtcaacagacgacaaagaac
gttgccgatcggcccgtaagcgaagtatctgtaccgtccgtgttgcgtgacaggacttca
gagcaatcggatggcgttactaagaaaaacgtgacagatgatgacagtactgcgtggagt
cagaatcagcagaaacagttggagattgcgttacagaagtttccgaagactgtggcagat
agatggacttgtatagctcaggctgtgcctggcaagactaaggaagaatgtattttgcgg
tacaaatttctcgtggaatgtgttcggaaaaaaaagctggccgggcagcaacagtaa

KEGG   Pocillopora damicornis (lace coral): 113686277
Entry
113686277         CDS       T05773                                 

Definition
(RefSeq) dnaJ homolog subfamily C member 3-like
  KO
K09523  DnaJ homolog subfamily C member 3
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113686277
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pdam03110]
    113686277
Chaperones and folding catalysts [BR:pdam03110]
 Heat shock proteins
  HSP40 / DNAJ
   113686277
SSDB
Motif
Pfam: TPR_2 TPR_1 TPR_19 TPR_11 TPR_14 TPR_8 DnaJ TPR_16 TPR_17 TPR_12 TPR_9 ANAPC3 TPR_20 TPR_7 TPR_21 NARP1 YfdX ANAPC5 Alkyl_sulf_dimr EAD11 PRTRC_E HEPN TPR_4 4HB_MCP_1
Other DBs
NCBI-GeneID: 113686277
NCBI-ProteinID: XP_027059682
LinkDB
Position
Unknown
AA seq 492 aa
MCSFGQLFSSLNIILITLELKIIGVSSKLSAAEVEQHLEQGKRLLATGQLSDALSHYHAA
VEGDPDNFLTYFKRATVFLAMGRSKAALPDLDRVLELRPDFFQARLQRGNVLLKQGRLDE
AHIDYEAVLHKNPDNAEALQQLNVIEPIRKDVSEARNAINMGDYSLAIEFLGRAIEVAPW
DTELRIMRADCHENMGDYINAISDIKPTTKLIPDNTAAYLRLSELHYGMGELEDALREVR
ECLKLDQDHKDCFPFYKKLKKLNKQMQAAQDLINKGEYEEAISKLKQALKTESKIPSLAA
KARRQLCHCHLKLHNPTDAITECNEALKIDENDVDALCDRAEAHILNEMYDDAVNDYQKA
KSINEHLHKVQEGLDRAQKLLKQSKKRDYYKILGLKRTASKKEILKSYRKLAVKWHPDQY
KGDDKKKAEKMFIDVAAAKEVLTDPEKRAKYDNGEDPLDPEQQGGGHHHWQQGGFPFGGG
FGEGFQFKFHFN
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgtgtagttttggacaacttttttcgtcgttgaatattattttaatcactttggaactg
aaaataatcggagtttcgagcaaattatcggcagcagaagttgaacaacatttagaacaa
ggcaagagattgcttgccactggacaactaagtgatgctctctcacactatcatgcagca
gttgagggtgatcctgacaattttttgacatattttaaaagagcaacagtatttctagca
atgggtcgttcaaaagctgccttgcctgatctggacagggtacttgaactaagacctgac
ttttttcaggcacggttacaaagagggaatgtcttactcaaacaaggaagattagatgaa
gcacacattgattatgaggcagtgttacataaaaaccctgataatgctgaagcactgcaa
cagttaaatgttatagaacccattaggaaggatgtctcagaagcaagaaatgcaataaat
atgggagactattcacttgctatagagttcttaggaagagcaatagaggttgccccttgg
gatactgaactaagaataatgagggctgactgtcatgaaaacatgggagactacatcaat
gcaatttcagacatcaagccaaccactaaactgatccctgacaacacagcagcatatctt
agactcagtgagttacattatggaatgggagagttggaagatgcattaagggaggttcgc
gagtgcctcaagcttgatcaagatcacaaagattgttttcctttttacaagaaattaaaa
aaattgaataagcagatgcaagccgctcaagatttgatcaacaaaggagaatatgaagaa
gctatatccaaactcaaacaggctctcaaaacagagtctaaaatcccttcactagcagcc
aaggcaagacgccagctatgccactgtcacctcaagcttcataatcccaccgatgccatc
acagaatgcaacgaggcgttgaagatcgatgaaaatgacgttgatgcgttgtgtgacagg
gcagaagcacatatactaaatgaaatgtatgatgacgctgtaaatgattatcagaaggca
aagagtatcaacgaacacttacacaaggttcaagagggactggacagagcacagaaatta
cttaaacaatctaagaaacgggactattacaagatcctaggattgaaaagaacggcatcg
aagaaagaaatcttaaaatcatatcgtaaactggccgtcaagtggcatcctgatcaatac
aaaggagacgacaagaaaaaagctgagaaaatgttcatcgatgtcgctgcagcgaaagaa
gtcctcacagatcctgaaaaacgcgcaaaatacgacaatggtgaagacccgttagaccca
gaacagcaaggtggcggtcatcatcattggcaacagggcggatttcctttcggtgggggc
tttggagaaggttttcagttcaaatttcatttcaactaa

DBGET integrated database retrieval system