KEGG   Pocillopora damicornis (lace coral): 113667392
Entry
113667392         CDS       T05773                                 

Definition
(RefSeq) protein transport protein Sec24C-like isoform X1
  KO
K14007  protein transport protein SEC24
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113667392
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113667392
Membrane trafficking [BR:pdam04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    113667392
SSDB
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin
Other DBs
NCBI-GeneID: 113667392
NCBI-ProteinID: XP_027039011
LinkDB
Position
Unknown
AA seq 1232 aa
MMNQRPPMTGQRNMPFDGPAKGVGDNFMANAGSFPPHQGPSNAMANGPQQVQMNGVSSQQ
DPNRYHPGYYQQPKQPLSPKAGDQFQGSLMQQPSQRLSPSPHQPINSSPTPPDQQKQQFP
PVSQHQQPPKPGELSQQQQPQSRPGLPPQQQQPQRPGGFPYQQTPSQPGGPSPYQQPQRP
GMPPQPLRPMAPTQGQQPPRPGGGNPAQRYPPLPQGHTSGHQHQQMTQQMSNLNITSSQS
QPSSSQQANLGSWPPQPSTTQVPFGGTPTTAPQPSYLGSQMQQPTNRPPGPPTMPSMPPM
TQPGFPPQTSSGAPPMGGMTQPPMGRHNATQMQPMPGSYPGPQVSMSGPSFSGSGSAGLT
SLSGPTLSQAAPPSGSSGAGMSHSALHSGRRMYPGHAPSQSPVQNQPSGGTTGMASHTGQ
SMYPGAPTMGGMPPTGPGQHGMGHPTPMNAPMQQQRRIDPDQMPSPIQVMKDDNDAFKDS
PYLTSTRGRTPPLVTSNFVVQDDGNCSPRFMRSTMYNIPCNKDLLQASSIPLATVITPFA
EPGPSEPSLRIMDYSPTGPVRCNRCKAYMNPFVQFVDGGRRFMCNICSYSSEVPAEYFCH
LDHQGMRLDVYERPELHLGSYEFVATKDYCKDQKMPGAPAYVFMIDVSYQSMQCGMVRML
MKELKEVLDVLPKEHGQEASSVRVGFVTYSNHLHFYNVKGNLAQPQMMVVSDIEDVFVPL
VDGFLVSPQEARTVIDSLLVQIPLMFGETRETETVLGPVIQAGMEALKAAGISGKLFVFH
SSLPISEAPGKLKNREDRKLLGSEKEKAILTPQNTFYEKLAKDCVANGVGVDLFLFPNAY
IDVATIGSVATLTGGQIYRYSYFKEATHGEQFRGDLKRNLERNVGFDAVMRLRCSTGLRP
VDFWGNCYMNNTTDVELAVIDPHKAIAIEIKHDDKLPEEGQAYFQCALLYTSVSGQRRLR
IHNLAFSTCTQLSDLFRCCEMDTFVNVASKQAIREVYTSTPKAIRENLMNQCAQILACYR
RNCASPSSAGQLILPECMKLLPLYTNCILKNDILLGGSEMSSDDRSWLMRTVMSMDQAAS
VPYFYPRLFALHDLKEESSGLPAVIRCSADRMSENGVYLLENGISLFLWIGLQVDPNWLH
QVFGVQTIGQVDIEMTSLPVLDNPLSTRLNEIIRLIQNQRQHYLKLTVVRQRDKLEGWFK
HFLVEDKGVNPVAHSYVDFLCQMHKEIRNLMN
NT seq 3699 nt   +upstreamnt  +downstreamnt
atgatgaatcaacgtcctcctatgacaggtcaaaggaatatgccattcgatgggccagca
aagggtgtgggagataattttatggcaaatgcaggcagttttcctcctcatcaaggtcca
tctaacgcaatggcgaatggccctcaacaagtccagatgaatggtgtgagttcccaacag
gatcccaatcgatatcatcccggttattatcaacaaccaaagcagccactttctcctaag
gctggtgaccagtttcaaggttcccttatgcaacaaccaagtcagcgactttcaccctct
cctcaccagccaattaattcctcacctacccctcctgatcaacagaagcaacagttccct
cctgtttcacagcatcaacagccccctaagcctggagagttatctcagcaacaacaacca
cagtcaagacctggtttacccccacaacagcagcagccacagagacctggaggcttccca
taccagcagacaccatcacaaccagggggtccctctccttatcaacagcctcagagacct
ggaatgccccctcagcctttaagaccaatggcacccactcaagggcaacagccaccaagg
ccaggtggaggaaatccagctcagcggtatccacctctgccacaaggacatacttctgga
catcagcatcaacagatgactcagcagatgagcaacttgaatatcactagttcccaaagt
caaccatcatcatctcaacaagcaaacttaggaagctggcctccccagccaagtaccacg
caagtaccatttggtggaacaccaacaacagcccctcagccatcatacttgggttcccag
atgcaacaacccacaaatcgacctcctggccctccaacaatgcccagtatgccaccaatg
acccagcctggtttcccccctcaaacctcttcaggtgcacctcctatgggaggcatgacc
caacccccgatgggtagacacaatgccacgcaaatgcagccaatgccgggttcataccct
ggtccccaggttagtatgtcaggtccttcttttagtggttctggaagtgctggactgaca
agcttgtcaggaccaacgctcagccaggctgcacctcctagtgggtcttctggtgctggg
atgtcacatagtgccttgcatagtggtcggcgcatgtacccaggtcatgcaccttctcag
agtcctgtgcagaatcagccatcaggtggaactacaggaatggcatcacatacaggccag
tcaatgtatcctggggcaccaactatgggaggaatgccaccaacaggtccagggcagcat
ggaatgggacatcctacaccaatgaatgctccaatgcagcaacagagaagaattgatcct
gatcagatgcccagcccaatccaagtgatgaaagatgacaacgatgcattcaaagactca
ccatacctcacaagcacaagaggaagaactcctccactggttaccagcaactttgttgta
caggatgatggaaactgcagtcctcgtttcatgaggagtactatgtataatataccatgt
aacaaagatttactgcaagcctccagcatacctttggcaacagttataaccccatttgct
gaaccaggcccttctgagccatcccttcgcatcatggactacagccccacaggacctgtg
cgatgtaatcgatgtaaggcgtacatgaaccccttcgtacaatttgttgatggtggaaga
agatttatgtgcaatatctgttcatactcatcagaagttccagcagaatacttctgtcat
ctagaccaccagggaatgagacttgatgtctatgaaagacctgaacttcatcttggatcc
tatgaatttgtagccactaaagattattgtaaggatcaaaagatgcctggtgctcctgca
tatgtgttcatgattgatgtgtcatatcaaagtatgcagtgtgggatggttagaatgctc
atgaaagaacttaaagaggtcttggatgtcttacccaaagagcatggccaagaagcctca
tcagtcagagttggatttgtaacatacagcaatcatttgcatttctacaatgttaagggc
aacctagcacagccgcaaatgatggtggtgtcagatattgaagatgtatttgtgccccta
gttgatggctttttagtgagtcctcaggaagcaaggactgtgattgatagccttctggtg
caaattcctttaatgtttggagaaacaagggaaacagagacggtgttaggtccagttatc
caagctggaatggaagctttgaaggccgctggtatttcaggtaaactgttcgttttccac
tcatctctgcccatttcagaggcgcctggaaaattaaagaacagagaggacagaaaactt
cttggctctgaaaaagagaaggcaatacttacacctcagaataccttttatgagaaactt
gccaaagactgtgttgcaaatggcgtgggagtggatctgtttttgtttcccaatgcctat
attgacgttgcaacgattggatcagtggctactcttacaggcggacagatctacagatat
tcctacttcaaggaggcgacacacggagaacagttccgtggagatctcaagaggaacctt
gaacgtaatgttggttttgatgctgtcatgagactgagatgcagcacagggcttcggccg
gttgatttctggggcaactgttacatgaacaacacgacagatgtagagcttgctgtcatc
gatccacacaaggcgattgccattgaaatcaaacacgatgacaaacttcccgaggagggc
caggcgtatttccagtgtgcgttactctatacatctgtcagtgggcagcggcgtttaaga
attcacaacttggccttctctacctgtacgcagttatcagatttattccgttgttgtgag
atggataccttcgtcaatgttgcatcaaaacaagcgatcagagaagtatacacgtcgacg
cccaaagcgatcagagaaaacctgatgaatcaatgtgcacagatcttggcctgttacaga
agaaactgtgcttcaccgtcatctgctggtcagttgatacttccagagtgtatgaaactc
ttgccgctttatacgaactgtattttaaagaatgacattctcctaggaggttcagagatg
agttctgatgaccgtagttggttgatgagaacggtcatgtcaatggatcaggctgcatct
gtaccttacttctatccaagactttttgcattgcatgatctgaaagaggagtcgtcgggt
ctaccggcagtgatcagatgttctgctgatcgaatgtcagagaatggtgtttacctgctg
gaaaatggaatatccctgtttttgtggattggacttcaagttgaccccaactggctccac
caagtttttggagttcaaacaattggacaagtcgacattgaaatgacttcacttccagtc
cttgataatcctctctctactcgcttaaatgaaatcattcgactgattcagaaccagaga
cagcattacctcaagttaaccgtcgtacgacaacgcgacaagctcgaaggatggttcaaa
catttcttggtggaagacaaaggtgttaacccagtggctcatagctatgtggacttcctt
tgccagatgcacaaggagatcagaaatctgatgaactaa

KEGG   Pocillopora damicornis (lace coral): 113668969
Entry
113668969         CDS       T05773                                 

Definition
(RefSeq) protein transport protein Sec23A-like
  KO
K14006  protein transport protein SEC23
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113668969
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113668969
Membrane trafficking [BR:pdam04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    113668969
SSDB
Motif
Pfam: Sec23_trunk Sec23_BS Sec23_helical zf-Sec23_Sec24 Gelsolin
Other DBs
NCBI-GeneID: 113668969
NCBI-ProteinID: XP_027040754
LinkDB
Position
Unknown
AA seq 772 aa
MTSYQDFITQNEDRDGVRFSWNVWPSSRLEATRMVVPVGCMYTPLKERPDLPPICYDPVL
CTRNTCRAVLNPFCQVDYRSKVWHCNFCFQRNAFPPQYAGISEQHQPAELIPQFSTIEYT
LQRGGTSGPLIYLIVLDTCMDDEDFQAVKESLQMSLSLMPPNALVGLITFGKMVHVHELG
CEGCSKSYVFRGTKDLNAKQIQDMLGLGGSGRGQQQQMRGGPVPPQQQSNETFNRFLQPV
HKCDMSLTDLLGELQRDPWPVPTGKRPLRSTGVALSIAIGLLECTYPNTGGRIMLFMGGP
GTQGPGMVVDEELKNPMRSHHDLEKDNARHVRKAIKHYEALSRRAAENGHVVDIFACQLD
QTGLHEIKSFPNVTGGYMVMGDSFNTALFKQTFQRVFSKDMRGEFKMAFCATLEVKTSRE
LRVSGAIGPCISLDRKGPNVSETEIGVGGTCAWKMCGLEPQTTLGVFFEIVNQHTAPVPQ
GGRGCIQFITQYQHSSGQRRVRVTTCARNWVDASNVQHIAMGFDQEAAAVMMSRVAVFRA
EGDDGPDVLRWLDRMLIRLCQKFGEYHKDDPGSFRLADNFSLYPQFMFHLRRSQFLQVFN
NSPDETAYYRHILNREDVTNSLIMIQPILYSYSFHGPPEPVLLDSSSILVDRILLLDTFF
QILIFHGETIAQWKKAGYQSDPQYESFRQLLQAPVDDAGEILQVRFPMPRYIETEHGGSQ
ARFLLSKVNPSQTHNNMFAWGQDAAGAPVLTDDVSLQVFMEHLKKLAVSNTS
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgacttcgtaccaggactttataactcagaacgaggaccgtgatggtgttagatttagc
tggaatgtttggccctcgagtcgactggaagctacgcgaatggttgttcctgttggttgt
atgtacacaccgttgaaagaacgaccagaccttcctccaatctgttatgatcctgttttg
tgtacaaggaacacttgtagagcagtgttgaacccgttttgtcaagtggactatcgatct
aaagtttggcactgcaatttttgcttccaacgaaatgcgtttcctcctcagtatgctgga
atatcagaacagcaccaacctgctgaacttattcctcagttttcaaccattgagtacact
ctacagcgtggaggcacctctggtccattgatatatctgatagtgttagacacatgcatg
gatgatgaagacttccaggctgtgaaggaatctctgcaaatgtctctgagtctaatgcca
cccaatgcattggttggtctcatcacatttggtaaaatggttcatgtccatgagctggga
tgtgaaggttgctccaagagttatgtcttcagaggaacaaaggaccttaatgctaaacaa
atacaggatatgcttggcctaggaggcagtgggcgaggacaacagcagcaaatgagagga
ggacctgtaccaccacaacaacagtccaatgaaacatttaacaggtttctccaaccagtc
cacaaatgtgatatgagccttactgatctattgggagaacttcagcgagatccttggcct
gttccaactggcaaaagacccctaaggtcaactggtgtggcattgtccattgctattggt
ctgcttgagtgcacatatcctaacactggtggtagaatcatgttgttcatgggaggacca
ggaacacagggaccaggtatggtggttgatgaagagttaaaaaatccaatgcgatcacat
catgatcttgagaaagacaatgcaagacatgtcaggaaagctattaagcattatgaagca
ttgtcacgccgtgctgcagaaaatgggcatgttgtggatatatttgcatgtcagctggat
cagacaggacttcatgaaatcaagagttttcctaatgtcacaggaggctacatggtgatg
ggagattcattcaacacagcacttttcaaacagacatttcagagagtgttttccaaagat
atgcgtggagagtttaagatggctttttgtgctacacttgaagtgaagacatcaagagag
ttgagagtgtcaggtgccattggaccatgtatatcgttggacagaaaaggacctaacgtt
tctgaaacagaaattggagttggtggaacatgtgcatggaagatgtgtggattagagcct
cagacaacacttggagttttctttgaaatagttaaccagcacacagccccagtcccccaa
ggagggcgtggctgcatacagtttatcactcagtatcaacattccagtggccagcggaga
gttcgagtcacaacgtgcgcacgaaactgggtagatgcatcaaatgttcaacacatcgct
atggggttcgaccaggaggctgcagccgttatgatgagcagagtagctgttttcagagct
gaaggagatgatggacctgatgtgttgcgctggttggatcgcatgctcattcgactatgt
cagaagtttggtgaataccataaggatgacccaggctcttttcgtttggcagataacttc
tcactttatccacagtttatgtttcatcttagacggtcacaattccttcaagtgttcaat
aacagccctgacgagacagcctactacagacacattttaaaccgtgaagatgtaacaaac
tcgttgattatgattcaacctatcctgtactcatattcctttcacggcccccctgagcct
gtgttgttagactctagcagtattttagttgacagaattcttctcctggacacattcttt
cagattcttattttccacggagagacaatagcacagtggaaaaaagccggttatcaaagt
gatccacagtacgagagtttccgtcagcttcttcaggctccagtagatgacgcaggtgaa
atcctacaggttcgcttccccatgccgcgttacatcgagactgaacatgggggctctcag
gctcgtttcttgctgtccaaagtaaacccgtctcagacccataacaatatgtttgcttgg
ggtcaagatgcggctggagctcctgtgctcaccgatgacgtcagtttgcaagtgtttatg
gaacatctcaagaaactcgctgtgtctaacacttcctaa

KEGG   Pocillopora damicornis (lace coral): 113673265
Entry
113673265         CDS       T05773                                 

Definition
(RefSeq) protein transport protein Sec24A-like
  KO
K14007  protein transport protein SEC24
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113673265
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113673265
Membrane trafficking [BR:pdam04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    113673265
SSDB
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin Vps36-NZF-N DUF3458_C
Other DBs
NCBI-GeneID: 113673265
NCBI-ProteinID: XP_027045453
LinkDB
Position
Unknown
AA seq 1216 aa
MSGGRLPPSHNAFSVGQQQPYLNHGGVNSFESSQNHGEFVQPDKKGVSQESQHTSIVNNQ
TQSVSQDMNPASKGYQAQYPGQWPTSLSPGHNQYRTNPPMVNNMVGASPHSLNNSHESSS
ALPPNRSPMNLQTGQSGNHSPSPNAIANGPVSGVGPPIGSSPSQPRMGQAVPNLSAPTHG
QSTPPSGSALANGPSLNSNSQQQTIINNTHGMQQTGSAFTPVTSHSGQSSLYQNSSSMPP
LPSQSRTGLPVHGQSNTPPQMSQVGQNTNYSGHAQGFPSGLSTTIGQPGSQPLSALHSNK
PKRPTMPMTTGPGHPGQGGSPLQRSTPPPSAGFPGSTMGQQVMPPPPTGPGGATPGQSLT
PPPPSMSPGSAMPQTGFNSPPTGYSPTGQDSQAGRPISSRRRMYPSQPMQPPMPGPGGMM
NAPGQMNQPYPGQMSPMAQQPPVSGNTQQFPSSGLEGPMGRLTVQQSSACQPINLLEQRH
VLPQTPIEQPTPNLPGDLRKRNCDPSVLCCTVNAVPETKSLLTKSKLPLGIHLHPFKDLQ
NLPVIHSSVITRCRSCRTYINPFVTFTDSRRWRCPMCFRVNEVPEEFCFDPTTRQYGDPS
KRPEVRNATVEFIAPSEYMLRPPQPAVFLFVMDVSFNAIETGYLHMVCKLLKENLEKMPG
DLRTQIGFITFDSTVQFYSLKSKLSQPQMNIVSDLEDIFLPSPDDLLVNLNESKELVTQL
LDSLPTMFNSNHNVHSATGAALQAALKLVGHIGGRVTLFQTTLPNIGPGQLKKREDGQKS
SPKDVQNLTPATDFYKKFALDCAAEQVAVDLFLLSGQYADIATLMCASKYSGGSVMYYPD
FHASRNPAAAEKFENEFVRYLTRKIGFEAVMRVRCTKGLSIHTFHGNFFVRSTDLVSLPN
VSPDSGFSMQIDIEDSLTDSNLAVFQSALLYTSTKGERRIRVHTLALPITNKLADLYATA
DVQAIATLLAKMAVDRTLTSSLGDAREALLNACIDTLSVYRSSVANQPQSSGLIAPYSLR
LLPLFILAIMKHMAFRLGSTSRLDERCFSMQQLKVMPLSLVMLSIYPKMYPIHELSDEGA
FQTKSGLVAKPPIYHLSGEKLTRKGIFLLDAGHAFYFWVGRDAPIDVIQAIFNVPNYGSI
PENMGSLPALENPQSERVRTFLDYLQTQRSCHANIFVLKEDGRMRGLFLQNLVDDRSESV
MSYYEFLVHIQKQISK
NT seq 3651 nt   +upstreamnt  +downstreamnt
atgtctggaggaaggttaccgccgagtcataatgcgttctcggttggtcaacagcaacca
tacctcaaccacggtggtgtaaatagttttgagtcttcgcaaaatcatggagaatttgtg
caaccagataaaaaaggagtaagtcaggaatctcaacacacgtctattgtcaataatcag
actcagagtgtttcccaagacatgaacccggcttcgaaaggttaccaagctcagtaccca
ggccaatggcctacatctctatcaccaggccataatcaatacagaaccaaccctccaatg
gttaataacatggttggcgcatcaccacattctttgaataattctcatgaatcctcatca
gcattgccacccaacagaagtccaatgaatctgcaaactgggcaatctggaaatcactct
ccatctcctaatgccattgctaatggtcctgtctcaggagttggcccccctattggaagt
tctccttcacaacctagaatgggacaagctgtaccaaatcttagtgcacccacccatgga
cagtccaccccaccttcaggatctgctttagcaaatggaccctccctaaattccaattct
cagcagcaaaccataattaacaatactcatggaatgcaacaaactggttctgctttcact
ccagttacctcccattcagggcaatcatcactgtatcaaaattcatcctctatgccaccc
ctcccaagtcagtcacggactgggttgcctgtacatggacagtcaaataccccaccccag
atgtcacaagttggacagaacacaaattacagtggacatgctcaaggttttccatctggt
ttatctacaaccataggtcaaccaggttctcagccattgtcagctcttcattccaataaa
ccaaagagacctacaatgccaatgaccacagggcctggtcatccagggcagggtgggagc
ccattgcagagatcaacacctcctccttcggctggttttccggggtcaacaatggggcag
caggtaatgccaccccctccaacaggtccagggggtgcgacaccaggtcagagtctaacc
ccaccccctccatcaatgtctccaggatcagctatgccacaaactggttttaacagtcca
ccaacaggatattctcccactggacaggactctcaggctgggagacccatttcttcgaga
aggaggatgtacccttctcagccaatgcaacctccaatgcctgggccaggtggaatgatg
aatgctcctggccagatgaaccaaccttatccaggtcaaatgtctcctatggctcaacaa
ccacctgttagtggtaatacacaacagtttccatcttctggcctggaaggtccaatggga
agactaactgtgcagcaatcttcagcttgtcaacccattaatcttttagaacaaaggcat
gttcttccccaaacacccattgagcagccaacccctaatttacctggagacctacggaaa
aggaactgtgatccaagtgtgttgtgttgcactgttaatgctgttccagaaaccaagagt
ctgttgacaaaatctaagctcccactaggaattcaccttcacccttttaaagatttacag
aaccttccagttattcattcttctgtcattacaagatgtcgttcctgtagaacatatatc
aatccttttgtaacctttactgactctagaaggtggagatgcccaatgtgtttcagagta
aatgaagttccagaggaattctgttttgatcctacaacccgacagtatggagatccatcc
aagagaccagaagtgaggaatgctacagtggaatttatagcaccatcagaatatatgtta
aggcctccacagccagcagtatttctgtttgttatggatgtctcctttaatgcaatagag
acaggttatctgcatatggtttgtaaattactgaaagaaaacttagagaaaatgccagga
gatttaagaacacagattggatttataacatttgatagtacagttcaattctacagttta
aagtcaaagctttcacaacctcagatgaatattgtttcagatttggaagacattttcctt
ccatctcctgatgaccttctggtgaatttgaatgaaagtaaagagcttgtaactcaactg
ctggattctcttccaactatgttcaacagcaatcacaatgtacacagtgcaacaggtgca
gccctacaggctgctctcaaattagtgggccacataggaggtcgtgtgacactttttcag
acaacgttgcctaacattggcccaggacaattgaagaagagagaggatggacagaaatct
tctccaaaggatgtccagaatttaacaccagctacagatttctacaagaagtttgcactg
gactgtgcagctgaacaagttgctgttgatctgttcttgctttcaggacagtatgctgat
attgctaccttaatgtgtgcgtcaaagtactctggaggatccgtcatgtattatcctgac
tttcacgcgtcaaggaaccctgctgcagcagaaaaatttgaaaacgaatttgtgcgttat
ctaacaaggaagattggatttgaggccgttatgagagtgcggtgcacaaaagggctttca
atccacaccttccatggaaatttctttgtacgctccacggacttagtttctttgccgaac
gtgagtcctgacagtggctttagcatgcagattgacattgaagactcgctgacagactcc
aatctggctgtgtttcagtctgctcttctctatacaagcaccaaaggtgaacggcgcatc
agagtacacactcttgctttgccgatcacaaacaagttggctgatctgtacgccactgct
gacgtacaggctattgccaccctgcttgccaaaatggctgtcgataggacactgacttca
tccttaggggatgctagagaggctttgttgaacgcgtgtattgacactcttagcgtttac
cgttcctcggtagcgaatcaaccacagagtagcggactgatagcgccctattctctgaga
ttacttccgctctttatcttggctatcatgaaacacatggcgtttcgtcttggctcgacc
tctcgtttggacgagcggtgtttttccatgcagcagcttaaagttatgcccctcagtttg
gtcatgttatctatttatccaaaaatgtatccgatacacgaattgtcggatgagggtgct
ttccagactaaatctggcctggttgctaagcctccaatttatcacctgtcgggcgaaaag
cttaccagaaaaggaatatttcttctggacgctggtcatgctttttacttttgggtcgga
cgagatgcccctattgatgtcatccaagctatattcaatgtaccaaactatggtagcatt
ccagagaatatgggatcgctgccggcgctggaaaatcctcagtcagagagagtgagaaca
tttttagattatctacagacacagcgatcttgccatgcaaacatctttgttttaaaggaa
gacggtcgaatgagggggctattcctccagaatcttgtggacgatcgttcggaatcggtt
atgtcttactacgagttcctcgtccatattcaaaagcagatttcaaagtga

DBGET integrated database retrieval system