KEGG   Pocillopora damicornis (lace coral): 113667521
Entry
113667521         CDS       T05773                                 

Definition
(RefSeq) casein kinase II subunit alpha-like
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam03008  Ribosome biogenesis in eukaryotes
pdam04137  Mitophagy - animal
pdam04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    113667521
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113667521
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    113667521
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdam01001]
    113667521
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pdam03009]
    113667521
Enzymes [BR:pdam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113667521
Protein kinases [BR:pdam01001]
 Serine/threonine kinases: Other
  CK2 family
   113667521
Ribosome biogenesis [BR:pdam03009]
 Eukaryotic type
  90S particles
   Kinase
    113667521
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH ABC1 Pkinase_fungal Kdo RIO1 Choline_kinase TCAD9
Other DBs
NCBI-GeneID: 113667521
NCBI-ProteinID: XP_027039155
LinkDB
Position
Unknown
AA seq 374 aa
MANTARARVYSDVNVHRPREYWDYESHVIEWGQQDNYELVRKLGRGKYSEVFEAINVSSE
DMEKVVVKILKPVKKKKIKREIKILENLRGGPNIINLLDVVKDPVSRTPALVFEYVNNTD
FKQLYQKFTDYDIRFYLYELLKALDYCHSMGIMHRDVKPHNVMIDHDKRQLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDHQEYDYSLDMWSFGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVIGTDELFEYIEKYHIELDPRFNDILGRHSRKRWERFTHSENELLVSPEAIDL
LDKLLRYDIAERLTAREAMEHPYFHPVVRQEQQRLAQTVVSPVPMQSSGTPTQQIVSPLP
SAPTSPLPNSTLPA
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcgaacacagctcgtgccagagtctactcggacgtaaatgtacaccggcctagagag
tattgggattatgaatcgcatgttattgaatggggtcaacaagataactatgaacttgtt
cgcaaactgggtagaggaaaatatagtgaagtttttgaagcaataaatgtgtcaagtgag
gacatggagaaagtggttgtaaaaattttaaagccagttaaaaagaagaaaatcaagaga
gagataaaaattctagagaatctgaggggagggcccaatattattaatcttctggatgtt
gtcaaagatcctgtgtccaggacacctgcattagtttttgagtatgtaaacaacactgat
tttaagcaactgtaccagaaatttaccgattatgacatcagattctacttatacgaactc
ctaaaggcattggactattgtcacagtatggggataatgcacagagatgtaaagccacac
aatgttatgattgaccatgacaaaagacagttacgattgatagattggggcttggcagag
ttttaccatcctggacaagaatacaatgttcgagtggcttccagatatttcaaaggacct
gaattactggttgaccatcaagaatatgactattccttggacatgtggagttttggttgt
atgctggccagcatgattttcagaaaagaacctttctttcatgggcatgacaactatgac
cagcttgtcagaattgccaaagtgataggaacagatgagctgtttgaatatatcgagaag
tatcatattgaattagacccaagattcaatgacatcttagggagacattcaagaaagaga
tgggaaagattcacgcattcagagaatgaacttctagtgagccctgaagcaattgacttg
ctggacaaactcctaagatacgacattgcggaacgcttgacagcaagggaagccatggaa
catccgtacttccatccagtggtgagacaggagcaacagagattagcgcagactgttgtg
tccccagtgcctatgcagtctagcggtacaccaactcaacagatcgtctcgcctttaccg
tcagcgccaacgtctccgctaccaaattcgactcttcctgcatga

KEGG   Pocillopora damicornis (lace coral): 113676995
Entry
113676995         CDS       T05773                                 

Definition
(RefSeq) casein kinase II subunit beta
  KO
K03115  casein kinase II subunit beta
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam03008  Ribosome biogenesis in eukaryotes
pdam04137  Mitophagy - animal
pdam04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    113676995
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113676995
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    113676995
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pdam03009]
    113676995
   03036 Chromosome and associated proteins [BR:pdam03036]
    113676995
Ribosome biogenesis [BR:pdam03009]
 Eukaryotic type
  90S particles
   Kinase
    113676995
Chromosome and associated proteins [BR:pdam03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     113676995
SSDB
Motif
Pfam: CK_II_beta CCDC24
Other DBs
NCBI-GeneID: 113676995
NCBI-ProteinID: XP_027049546
LinkDB
Position
Unknown
AA seq 223 aa
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDMEPDD
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGLAQMLEKYQNGDFGHCCRVYCENQAVL
PIGLSDVPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPN
NQFVPRLFGFKISPMAYQIQERAAAQRGRSASARPRSTKPHYK
NT seq 672 nt   +upstreamnt  +downstreamnt
atgagtagctcagaagaggtgtcgtggatttcttggttttgtggtcttcgtggtaacgag
tttttctgcgaggttgacgaagattacatccaggacaagtttaatttaactggattaaat
gaacaagtgccacattacaggcaggccttggacatgatactggacatggagccagatgat
gaattagaagataatccaaatcaaagtgatctgattgaacaggcagcagagatgttatat
ggtctcattcatgctcgttatatattaaccaacagggggcttgcgcaaatgcttgaaaaa
taccagaatggtgattttggacactgctgtcgagtgtactgtgaaaatcaggcagtctta
cccattggtttgtctgatgttcctggggaggcaatggtcaaactttactgtccaaaatgc
atggatgtttacacaccaaaatcatctcgacatcatcacacagatggagcatactttggg
acaggtttccctcacatgctgtttatggtacatcctgagtacagaccaaaaagaccaaac
aaccagtttgttccaaggttgtttggatttaaaatttcacccatggcttaccagatccag
gagagagcagcagctcagagaggacggtctgcatcagcacgtccaagatccacaaaacct
cattacaaataa

DBGET integrated database retrieval system