KEGG   Pocillopora damicornis (lace coral): 113667542
Entry
113667542         CDS       T05773                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase AMFR-like
  KO
K10636  E3 ubiquitin-protein ligase AMFR [EC:2.3.2.36]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113667542
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pdam04121]
    113667542
Enzymes [BR:pdam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.36  RING-type E3 ubiquitin transferase (cysteine targeting)
     113667542
Ubiquitin system [BR:pdam04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    113667542
  Multi subunit Ring-finger type E3
   ERAD complex
    113667542
SSDB
Motif
Pfam: zf-RING_2 CUE zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_UBOX zf-rbx1 zf-RING_11 zf-RING_5 G2BR zf-ANAPC11 Zn_ribbon_17 Prok-RING_4 zf-C3HC4_4
Other DBs
NCBI-GeneID: 113667542
NCBI-ProteinID: XP_027039186
LinkDB
Position
Unknown
AA seq 596 aa
MPLVFLEQLPLPSLQSYVTVSVLLFVSAVLYALNVTVGSDEKEELNIYDFMSQDNFCFWS
NLNMAYCCLFLFGKIIQRVVFGDLRASELQQIQDRFWNFIFYKFIFIFGVLNVQKFNEVM
WWTAWFTLLGFFHLFTQLCKDRFEYLSFSPTTSPWSHAKVIGLLNTLVLCCNGLFFICLF
IGWPDGIHTFTFMLAECMLLLIKIVHGLIRYGIHLWDIGHTSMWEGRSTWSYNTDMMMEL
ALYIVDFAHHLHMLVRMNXILILGTGKICIFLLNATCLIXHLIDGCLHMIRRFPLATEEE
LIKNNDDCAICWDSMVAARKLPCGHLFHNSCLRSWLENDTSCPTCRQSLASDLQPEQEEQ
RQSRGVAAFMMGRGLRRNHFFHFDGSQIASWFPSFSVEVMHTGVENAAEGQLPESRIEAM
AHQVQAMFPNMPFNIIMEDLRHTHSLEVTTDNILEGNIAVPSVWTPPEEQSEDSELLQIA
HPDSLTPSNTPEETESSTSETEQDSTEASNNAEVMREQALEEAASLEQRPKRDESPPPNE
TPPGERYRSVSPSLMEFSTQSSVRQSLLLKRKEMMLQQARRRFMDKEVSNQSESSQ
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgccgttggtttttctcgaacaactgcctcttccctctctgcaatcatatgtgactgta
agcgtgttgttgttcgtttcggccgttctctacgcattgaatgtcactgttggttctgat
gagaaggaggagttgaatatttacgattttatgtctcaggataatttttgtttttggtcg
aacttgaacatggcctactgttgtttgtttttgttcgggaaaattatccaaagggttgta
tttggagatcttcgcgccagtgaacttcagcaaattcaagacagattctggaactttatt
ttctacaagtttattttcatctttggagttctaaatgtgcagaaattcaatgaagtgatg
tggtggacggcttggtttactctactcggcttctttcatttgttcacacagctctgtaaa
gacagatttgaatatttgtctttctcaccaacaacgtctccttggtctcatgcaaaagtg
attggtttactcaatactttggtgttatgttgcaatggattgttcttcatctgtcttttt
attggttggccagatggcatacacactttcacattcatgttggctgagtgtatgttgtta
ctgatcaaaatagttcatggtctgataaggtatggcattcatctgtgggatataggtcat
accagtatgtgggaaggaagaagcacatggagttacaacacagacatgatgatggaattg
gcattgtacattgtggactttgctcatcaccttcacatgttggtgagaatgaattaaata
ttaattcttggtacaggcaaaatttgtatatttttgttgaatgcaacttgtttaatttga
catctgattgatggttgtctgcatatgatccgcaggtttcccttggcaacagaagaagag
ttgattaagaataatgatgattgtgccatctgctgggattccatggttgcagcaaggaag
ctaccatgtggtcatcttttccataattcttgtctcaggtcgtggctggagaatgacacc
tcctgccctacctgccgccagtcacttgccagcgatctgcagcctgagcaggaggagcag
aggcaatcaagaggagtggctgcattcatgatggggcgtgggctaagaagaaaccacttt
ttccactttgatggttctcagatagccagctggtttccaagcttctctgtggaggtcatg
cacactggagtggaaaatgcagctgagggtcaacttccagagagccgcattgaagctatg
gcacaccaagtacaggccatgtttccaaatatgccattcaacatcattatggaggactta
agacacactcactcccttgaggtcaccactgataatattttggagggaaacatagcagtg
ccttctgtctggacaccacctgaggaacaatcagaggattcagagctccttcagatagca
cacccagactcactgacaccttcaaatacacctgaagaaactgaaagctctacaagtgag
acagaacaggacagcacagaagcatctaataatgcggaagtgatgagagaacaggcactt
gaagaggctgcctcgttggagcagcgtccaaagcgtgacgagagcccaccacctaatgaa
acaccaccgggagagagatacaggagtgtatcgccatctttgatggagttttcaacacaa
tcttcagtgagacagtccctgttgttaaagagaaaagagatgatgcttcaacaggcaagg
aggcgttttatggacaaagaagtctccaatcagagtgaatccagtcagtag

DBGET integrated database retrieval system