KEGG   Pocillopora damicornis (lace coral): 113668148
Entry
113668148         CDS       T05773                                 

Definition
(RefSeq) uncharacterized protein LOC113668148 isoform X1
  KO
K04526  insulin
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04068  FoxO signaling pathway
pdam04140  Autophagy - animal
pdam04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113668148
   04150 mTOR signaling pathway
    113668148
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113668148
SSDB
Motif
Pfam: Insulin Augurin
Other DBs
NCBI-GeneID: 113668148
NCBI-ProteinID: XP_027039823
LinkDB
Position
Unknown
AA seq 126 aa
MSYKINWISFVLIIWMLTTSLQIEASFFPCTPLSPPDRCRKIDEISGKQVSFHICGVQLT
TALVRFCRLRRKRNVKPRDSKVILDKQRADGFLTSQQVTKRNFDLVEECCREGCVLEELL
EYCKYF
NT seq 381 nt   +upstreamnt  +downstreamnt
atgagctacaagataaactggataagcttcgtattaataatatggatgctaaccacgtcg
ttacaaatcgaggcgtctttctttccttgtaccccgctttcaccacctgatcgctgccgt
aaaattgacgagatttccggaaagcaggtctcctttcatatttgcggcgttcaactcaca
acagctttagttaggttctgcagattgcgaaggaaaagaaatgtaaaaccaagagacagc
aaagtaatcctggacaagcaaagagctgacggatttctcacttcacagcaggtgactaaa
aggaacttcgaccttgtagaagagtgctgtcgagagggctgtgtgttggaagaacttttg
gaatattgcaaatatttttga

KEGG   Pocillopora damicornis (lace coral): 113676436
Entry
113676436         CDS       T05773                                 

Definition
(RefSeq) bombyxin F-1-like
  KO
K04526  insulin
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04068  FoxO signaling pathway
pdam04140  Autophagy - animal
pdam04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113676436
   04150 mTOR signaling pathway
    113676436
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113676436
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 113676436
NCBI-ProteinID: XP_027048896
LinkDB
Position
Unknown
AA seq 116 aa
MKESLLWTIVPFLAIVLSLEAVTGSKLVKAYEVGSRRIDAHICGDHIKEVYTKVCIDESV
GKRKRRSPLMEEKEALSFIHSESNRSLRKARSVRTVNIVEECCIEGCTIGELKEYC
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaaggaatcgttactttggaccattgtgccattcctggctattgttttaagtcttgag
gctgttacagggtctaaacttgtcaaggcgtatgaagttggatctaggcgaattgatgcc
catatctgtggcgatcatatcaaagaagtctacacaaaagtgtgtattgacgaatctgtt
ggaaagaggaaacgtagatcgcctttgatggaagaaaaggaggcactaagttttatacat
tctgaaagcaatagaagtctacgaaaagcacgttcagttagaactgttaatattgttgag
gagtgttgtatagagggttgcactatcggtgaattgaaggaatattgttga

DBGET integrated database retrieval system