KEGG   Pocillopora damicornis (lace coral): 113668222
Entry
113668222         CDS       T05773                                 

Definition
(RefSeq) mitofusin-1-like isoform X1
  KO
K21356  mitofusin 1 [EC:3.6.5.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    113668222
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pdam03029]
    113668222
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     113668222
Mitochondrial biogenesis [BR:pdam03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    113668222
SSDB
Motif
Pfam: Dynamin_N MMR_HSR1 PduV-EutP RsgA_GTPase ABC_tran IIGP AAA_22 GTP_EFTU AAA_29 Spore_IV_A Septin TsaE AAA_28 cobW AAA_33 G-alpha DUF4335 FeoB_N AIG1 bZIP_1
Other DBs
NCBI-GeneID: 113668222
NCBI-ProteinID: XP_027039905
LinkDB
Position
Unknown
AA seq 642 aa
MFAQFAPRIREIKLAREQLQDLVNALTETRDDVRRLLNEECSTSNEWQDFETVSNRIDRL
NASAIQLTTRAESKLQIAFVGSVGAGKSTLINALLGENIMPVTRAETTFCNVAVTGSSSD
EWTAVERSSGKSLEISEFRQLLHVLKAKEQRETLGLTPASIIDVKWPTARCKALVENVVL
YDTPGIGERKATDDAVTELCKFVDVIVAVMDIHSPSLRTVVDFVTAVSCRYTLGVFTKWD
MFQENHSSDDYTEIPTGDIKDRCVAEFMTAVSDRGKVFFIDSQTQREAVRCPLQQQNEAS
STTSDETETEGSRGFKEFERNLVEAAKGALKFDTLKYDMQAFVAQAKGLSGNLGRIMESR
KKKRIQRLSNRMNKLTDAENSIKSHLSQVSSILVDVVKRLQRDRQIAEFKMQIEHDMKNG
VSPENALDRCRDGLNHRLHVLVKKDKDLKEQLDCIWNCLSKVADGPGRLTFQVTEPTWKS
EDFQLDESFEYQGNDLHGCLTNPSLPSKMVCCGLLGALIYGQSGALISAIGVPAVNSLVP
WTDLNGWLKYFWPACQAEVTAVQKFFETKVKTLHEEKCEQVAVAGISDLKETAEIRVRGV
KRSLEDDIRFIQDGENFLNKRRRITDRLQSSFEAFEDKIHDI
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgttcgcacagtttgcaccaagaattcgagagataaagctcgcaagagagcagctacaa
gatttagtgaacgctttaacggaaaccagagatgatgttcgtcgtctccttaacgaagag
tgttccacctcaaacgagtggcaagatttcgagacagtctccaatcgaattgaccggtta
aacgcctctgcaattcagcttacaacacgggcggaaagtaaactgcagatcgcttttgtt
ggttccgttggcgccggaaaatcgactttgataaacgccttactcggtgaaaacataatg
cctgttactcgagctgagaccaccttttgcaacgtagcggtgaccgggtcttcaagcgac
gagtggacggcggtcgaaagaagctctggtaaatctctagagatttccgagtttcgacaa
cttcttcacgttctaaaagctaaagaacagcgggaaacactcggtctcaccccggccagt
attattgatgtgaaatggcctacggcgcgatgtaaggctcttgtggaaaatgttgtgttg
tacgatactccgggaataggcgaacggaaggctacagatgatgcagtgaccgaactctgt
aagtttgtggatgtcattgtcgccgttatggatattcatagccccagtttgagaaccgta
gtggatttcgtgacagctgttagctgcagatacactttgggggttttcaccaagtgggac
atgtttcaagagaaccattcttctgacgactatacagaaatcccgacaggcgacattaaa
gatcgctgtgtggcagaattcatgaccgctgtgtctgacagaggaaaggttttcttcatt
gactcgcagactcaaagggaagcagtgaggtgtcctttacaacagcagaatgaagcctca
tccactacttcagatgaaacagaaacagagggttcccgaggatttaaggaattcgaacgc
aatttggtcgaagcagctaaaggtgctttaaaattcgacacactcaagtacgatatgcag
gctttcgttgcacaagcaaaggggttgtcaggaaatctgggcagaataatggaaagccga
aagaaaaagagaattcagcggctctcaaaccggatgaacaagcttaccgatgccgagaat
agcataaagtcgcacctgtcccaagtatcaagtatccttgtagatgtagtgaagcgcctt
cagcgagaccgacagattgctgagttcaagatgcaaatagaacatgacatgaagaacggt
gtctctccagaaaacgccttagatcggtgccgggatggtttgaaccatagactccacgtt
ctggtgaaaaaggacaaagatctcaaggaacagttggactgtatctggaattgcctgtcg
aaagtggcagatggacctggtagactcactttccaagtaacggagcccacgtggaaaagc
gaggattttcagctcgacgagagtttcgaatatcaaggaaatgacctacacggctgccta
acaaatccaagtttaccttccaaaatggtgtgctgtggtttattaggagctttgatatat
ggtcaaagcggagctctaatctcagcaattggtgtacctgcggtaaacagtttagtacca
tggactgatttgaatggatggctgaaatacttttggcccgcatgtcaagctgaggtcact
gcggtccagaagttcttcgaaaccaaagtgaagacattacacgaggaaaaatgcgaacaa
gtggcagttgcaggaataagtgacttgaaagaaacggcggagattagagttcgcggtgta
aaacgttcattagaagacgatataagatttatccaggatggagaaaactttctcaacaaa
cggaggaggattacagatcgtctacaaagttcgtttgaggcttttgaagacaaaatacac
gatatttga

KEGG   Pocillopora damicornis (lace coral): 113673195
Entry
113673195         CDS       T05773                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: transmembrane GTPase fzo-like
  KO
K21356  mitofusin 1 [EC:3.6.5.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    113673195
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pdam03029]
    113673195
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     113673195
Mitochondrial biogenesis [BR:pdam03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    113673195
SSDB
Motif
Pfam: Dynamin_N MMR_HSR1 RsgA_GTPase IIGP PduV-EutP ApoLp-III ABC_tran Snapin_Pallidin Fib_alpha GTP_EFTU DUF3450 Lipoprotein_7 YkyA PFam54_60 ATG17_like LOH1CR12 AIG1 Prominin Med21 EAP30 AAA_29 AAA_16 HEF_HK Helo_like_N Roc CPT RmuC AAA_7 Vps51 TMF_TATA_bd DUF2203 TPR_MLP1_2
Other DBs
NCBI-GeneID: 113673195
NCBI-ProteinID: XP_027045368
LinkDB
Position
Unknown
AA seq 767 aa
MATAASAVSTSKKKWDGFKETAKKINELRDNIESLTKVMEEVKKVCDQFYKEYKNKIPSQ
PEEIKRFHDNLEKIVDELKGELEKAVSEDVTIVFVGRTSSGKSSLINALLQDSRLPVDKI
QTTMCKIQVRPTADEEWSIVKVGCQEPLTDHKSAEAVKGLLSKMSGKSETAEREKLRIDS
RSVIQVNWPRQLCNLPENIILIDTPGFKENYDGDIVVFDSCKEAEILVAVMDFMSPSMKD
IADLLNKMKFKLKFGVFTKWDKNLQDEKEEEKIKTTVKAGKRQQIRNVYKGYFQEFVNDE
CPVYFVDAKHFSKAKDTPQGFDGREDFLRFERDLAKGAGSVKAQKGVALIEHAKALASEH
ENIFNSVQRIFEERXNSSKDRLTEINNVMSTLEKEHRSLDAVIHEVKKLNYLINRHLTEG
EIDRLIEELRNDIKRCSTVQSENEAIDNFFSRKIGGINTALYEQTVKLEEEYEQRRGDLD
LSLAMYLRELLPSYEARELRGAEDSSYDDRRDPYAYVTSNNVWTVLWYFGFAAATVSAAV
VPAGAGAGLVAVVKPGATATAVAISGKAVAGGTFFGGTLGFSKLVEKVAGFGGFGQKIRH
YFGPSQMKVGDTTRFAREILIEIKRQFARFVSKLPEIQTTADERSSRLTNENDRFSREKS
ELNKELNKLTEWSNKVTESTKRLQNVRDGFDELKLGYINILHPNMKFTMEREENHELPLL
DVLLDNNSDQGIITTVFHKKTFTGLHTNLNSFVPFSYKSGLVRALVD
NT seq 2304 nt   +upstreamnt  +downstreamnt
atggcaaccgcagcatctgctgtatcgacgagcaaaaagaagtgggatggcttcaaggaa
acagccaagaaaattaacgaattgagggacaatattgagagtttgacgaaggtaatggaa
gaagttaaaaaggtctgtgatcagttctataaggagtacaaaaataaaattcctagccaa
ccagaggaaatcaagcggtttcacgacaacttagagaaaatagtggatgaattgaaagga
gaacttgaaaaggcggtatctgaagatgtaaccattgtgtttgtgggacgtacaagcagt
ggcaaatcgtccttgataaatgccttacttcaagacagccgtcttcccgttgataaaatt
cagacgacgatgtgcaaaattcaggttcgccctacggctgatgaagagtggagtattgtt
aaagtaggttgtcaagagccactcacagaccataagagcgcagaggccgtaaagggcctt
ttgagtaaaatgtctggtaagtcagaaactgcagaaagggagaagctcaggattgactct
cgcagtgtcatacaagtgaattggcctcgccagctctgcaatctgccagaaaatattatt
ttgatagatacacccggttttaaagagaactacgatggcgacatagttgtcttcgactca
tgcaaggaggcagagatactcgttgctgtgatggatttcatgtcaccttccatgaaagat
attgcagatctcctaaacaagatgaaattcaagctcaaatttggcgtctttacaaaatgg
gataaaaacttacaagatgaaaaagaagaggagaaaataaagacaacagtcaaagcaggc
aagcggcaacaaatacgaaatgtctacaaaggatattttcaggaattcgtcaatgacgaa
tgcccggtttatttcgttgatgcaaagcatttttccaaagcaaaggacactccgcaaggc
tttgatggaagagaggattttttgaggtttgagagagatttagcgaagggtgcaggatca
gttaaagcacaaaaaggcgtggctctaatagaacatgccaaagctctcgcttcagaacac
gagaatatcttcaatagcgttcaaaggatcttcgaggaaaggnggaattccagtaaagat
cgtctgactgagataaataacgtaatgagcactttggagaaagaacaccgtagccttgat
gcagtgattcatgaggtgaagaagctcaattatctgataaaccgtcacctcactgaaggg
gagattgatcgattgatagaggaacttcgcaacgacataaaaagatgcagcactgtgcaa
agtgagaatgaagctattgacaatttttttagtagaaagattggtggaatcaatacagct
ttatatgaacaaactgtaaaattagaagaagagtatgagcaacgcaggggtgatcttgat
cttagtctagcaatgtatttgagagaattgttgccgtcctatgaagctagagagctgaga
ggagcggaagattctagttatgacgatagaagagacccttatgcctacgttacaagcaac
aacgtctggacagtactttggtacttcggttttgcagctgccacagtatctgctgcagtg
gtaccagcaggggccggtgctggtctcgttgcggtggtaaagccaggagctactgctact
gctgtcgctatttctggaaaagcagttgccggaggaactttcttcggaggtaccctggga
ttttcgaagctggtggaaaaagttgcaggatttggaggattcggacaaaagataaggcat
tatttcgggcccagtcagatgaaggtcggcgacacgacacggtttgcacgagaaattttg
atagaaatcaagagacaatttgcaagattcgtctcaaaattaccagaaatacaaacgacc
gctgacgaaaggtcctcaaggttaacaaacgaaaacgatcgtttttccagagaaaagtca
gaactgaataaggaattaaataaactaacggaatggtcaaataaagtaactgaaagcaca
aagcgtttgcagaatgtccgagatgggtttgacgagctgaagcttggttatatcaacatc
ctacaccctaacatgaagtttactatggagagggaagaaaaccacgagctccccttgtta
gatgttcttttagataacaatagcgatcagggcattatcaccacggtgtttcacaagaag
accttcaccggtcttcacactaatttgaacagttttgtacctttcagttacaaatcagga
ttagtacgcgccctggtagactaa

KEGG   Pocillopora damicornis (lace coral): 113673196
Entry
113673196         CDS       T05773                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: uncharacterized protein LOC113673196
  KO
K21356  mitofusin 1 [EC:3.6.5.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    113673196
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pdam03029]
    113673196
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     113673196
Mitochondrial biogenesis [BR:pdam03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    113673196
SSDB
Motif
Pfam: Dynamin_N MMR_HSR1 RsgA_GTPase IIGP GCK ABC_tran GTP_EFTU DUF815 AIG1 HD_3 T2SSE AAA_29
Other DBs
NCBI-GeneID: 113673196
NCBI-ProteinID: XP_027045369
LinkDB
Position
Unknown
AA seq 785 aa
MEGRWRKFSLLIEDVKKLTKPLQEDTEKIAYILKDYEERLSVEGATLKEYDELSQLSQSL
NKVMDDLKNVREKEASKDILIQFVGTTGSGKSSLINALLGERRLPVGFMQTTMCSFRVCN
TENSEWSIEIIGENGRKEILSEGTDDKTVSNLLNKMGGXKNEQLRKEKGIGLRTIIQVNW
PANKRKKLPRNVILCDTPGFGESDEDMELVTQTCKKADVVVAVMDSMAPSRGRLINLVKN
VGCQFTFGVFTKWDECIRKAQEAGDESVRNVVKLANDYIKEFCEVLQGKGKAYFVNVKNF
ENPDDIFHQLENKLATSATELKRESLTQQAKSVALHSRKVCEKLKTVIETRKSEKLTCLQ
TELVWLIEDSVKLQKALDDIKSKDEDLEILTDDAVQLLLKEIEDELVKGTSEEEAVKHFL
DEVNREVQNHLNHKRDITRATLQEWKKNMQFRKLQSVNIPPSQAPPQLASQDLPEVKYKW
YCDFDYVLKNKFTFAALVGAAATLIELVKDVGCPFTFGVFTKWDECLRKAEKEGDDTVKN
VTETAEVFKKEFWEALQGKSKVYFVNVENFLEPNSSFQEFERTLATKATEIKGKSLTEQA
KSIALRSLEYCDRLKKAIGKKKTEKLQRLGEELASAKKGSKTLHNPFESIKSEDEDLQVS
TSDTNLLEEVNKKLSEGALEEHSVEFFLKKINEKTTKAIASKRDEISKAYQDWKKNTACR
KFQSFNLRFREPPQLQYRELPKEEYNCLFDPHYYYTNNFILPCTFGVVALASPAVALLVA
VKAGA
NT seq 2358 nt   +upstreamnt  +downstreamnt
atggagggaaggtggagaaagttttcactactaatcgaggacgtgaaaaagttaacaaaa
ccgctacaagaagatacagaaaaaattgcttatattttgaaggattacgaggagagacta
agtgttgagggagcaacgcttaaggaatatgatgaattgagccaattatcccaaagcctc
aacaaagtaatggatgatttgaagaatgttcgggaaaaggaagcctcgaaagatatactc
attcaatttgttggaacaaccggtagtggcaaatcatcccttataaacgctctactcggc
gaacgtcgtctgcctgttggattcatgcaaacaaccatgtgttcctttagagtttgcaac
actgagaacagcgagtggagtattgaaatcattggcgaaaatggacgcaaagagattctc
tcggagggaactgacgacaagactgtaagtaatctcttgaataaaatgggtggttaaaaa
aatgaacagctacggaaagagaagggaataggtctaaggaccattatacaggtaaattgg
cctgcgaacaaacgcaaaaagttaccacgaaacgttatcttgtgtgacacacccggcttt
ggagagagtgatgaagacatggagcttgtcacccagacgtgcaaaaaggcagacgtagtt
gtagccgtaatggattccatggcgccgtcaagagggagactcattaacctggtgaaaaat
gttggctgccaatttacttttggagtcttcaccaaatgggacgaatgcataagaaaagcg
caagaagcaggagacgagagcgtccgcaatgtggtaaaacttgccaatgattacattaag
gagttctgtgaagtgcttcaagggaaaggcaaagcttactttgtgaacgtcaaaaacttt
gaaaatcctgatgatatatttcatcagttagagaacaaactggccacgagtgcaacagag
ttgaagagagagtcactaacacaacaggcaaaatctgtagctttgcattccaggaaggtc
tgcgaaaagctgaaaactgtcattgaaaccagaaagagtgaaaagctaacttgtctgcaa
acagagttggtttggttaatagaagacagcgtgaagctacaaaaagctcttgatgacatc
aagagtaaggatgaggacctagaaattttaaccgacgacgcagtccaactgttattaaaa
gagattgaagacgaattggtcaaaggcacatcagaagaagaggctgttaaacactttctc
gacgaagtcaatagagaggtccaaaaccatttgaatcacaaaagagatataactcgtgct
accctccaagaatggaagaaaaacatgcaattccgcaagttacagtctgtcaatatacct
ccgtctcaagcacctcctcagcttgcaagtcaagatttacctgaagtcaaatacaagtgg
tattgcgactttgattatgtcctcaagaacaagttcacttttgcagccttggttggtgca
gcagctaccctcattgagctagtgaaagacgtaggttgtccattcacttttggagtcttt
acaaaatgggacgagtgcttgagaaaagcggagaaagaaggagatgacaccgtcaaaaat
gtgacagaaacagccgaggtcttcaaaaaggaattctgggaggctcttcaagggaaaagc
aaagtttacttcgttaacgtggaaaactttttagaacctaactccagttttcaagagttc
gagcgcaccttggccacgaaggcaacagagataaaaggcaagtcattaacagagcaggcg
aaatctatcgctttacgatccttggagtactgcgatcggttaaaaaaagccatcggaaag
aagaagacagaaaagctacagcgtctaggtgaagagttggcttccgcgaagaaaggtagt
aagactctacataatccttttgaaagcatcaagagtgaagatgaggatttacaagtttcc
accagcgacacaaacctgttagaggaagtaaataagaagttaagtgaaggagcattagaa
gaacattctgtcgaattcttcctcaaaaagattaacgagaagaccacaaaggctatcgca
agcaaaagagatgaaatcagtaaagcataccaagactggaaaaaaaacacagcatgccgc
aagtttcagtctttcaatttacggtttcgtgaacctccacagcttcagtatcgagaatta
cctaaagaagaatacaactgcttatttgaccctcattactactacacaaataactttatc
ttgccctgcacttttggtgttgtagctttagcaagtccagctgttgctctccttgttgcc
gtcaaagcaggtgcgtga

KEGG   Pocillopora damicornis (lace coral): 113681238
Entry
113681238         CDS       T05773                                 

Definition
(RefSeq) mitofusin-2-like
  KO
K06030  mitofusin 2 [EC:3.6.5.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    113681238
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113681238
   03029 Mitochondrial biogenesis [BR:pdam03029]
    113681238
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     113681238
Membrane trafficking [BR:pdam04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    113681238
  Other autophagy associated proteins
   ER-mitochondria tethering complex
    113681238
Mitochondrial biogenesis [BR:pdam03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    113681238
SSDB
Motif
Pfam: Dynamin_N MMR_HSR1 AIG1 T2SSE
Other DBs
NCBI-GeneID: 113681238
NCBI-ProteinID: XP_027054117
LinkDB
Position
Unknown
AA seq 420 aa
MKSRNAVWVAAHSGMGMDSPLTKSLNIQKVSTDNCISLTQVSGFLAQVSSISEIISRDQM
KVAFFGRTSNGKSTTVNAVLQDKILPMGIGHTTSCFLSIHGSDEPDPYILVPGSIDKKKV
ESLDELADALSQEKLDHSSLVQVFWPKSRCNILSEDVVLVDSPGIDVSPDLDLWIDEHCL
DADVFVLVANAESTLMVTEKNFFHKVNQRLSRPNIFILNNRWDASASEPDRMEQVKDQHL
SRNIGFLVDELQCEDKGQAKDRVFFVSAKETLSNRMKKSQGMRQGGGAIYVEGFGARQLE
FENFEWKLKECISKSAIKTKFESHAVSGLKIAKKLKILMEQRVGCASQQRSTQEKAKKEQ
ENRLKFVKEQLEISTREIKCLIKEITSKVEDQVTEAMTEEIVKCSVLGSQQSTLFSIYLS
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgaaaagtagaaacgctgtttgggtagcggctcattctggaatgggaatggatagtcct
ttgacgaaatccttgaacatacaaaaggtcagtactgataattgcatttccctcacacag
gtgtcaggctttctggctcaggtttcaagcatctcagagataatatcaagggatcagatg
aaggtggcattctttggacgaaccagcaatggaaagagcactacagtaaatgccgtgcta
caagataagatcttaccaatgggaattggtcatacgacaagctgtttccttagtatacat
ggctcagatgaaccagatccatatatcttggttcctgggagtattgacaaaaagaaagtg
gagtcactagatgaacttgctgatgccttatcccaagaaaagctagatcatagcagtctt
gttcaagtgttttggccaaagtccagatgtaatatcttatcagaggatgttgttttggtg
gatagtcctggtatagatgtgagccctgatcttgatctatggattgatgagcattgtttg
gatgctgatgtgtttgtcctggttgctaatgctgaatcaaccctcatggttacggagaaa
aacttttttcacaaagtgaatcagcgtctttcaagaccaaacatcttcattctaaataac
agatgggatgcatctgcatcagaacctgataggatggagcaggtgaaagatcaacatctc
agtagaaacatcggttttcttgttgacgagctccagtgtgaagacaaaggacaggcaaaa
gacagagttttttttgtctcagctaaagagaccctatcgaacagaatgaagaaatcccaa
ggaatgcgtcaaggaggtggtgccatttatgttgaaggatttggtgctcgacagttggag
tttgagaactttgaatggaaattgaaggagtgtatttctaagtcagccataaaaaccaag
tttgaatctcatgcagtcagtggattgaaaattgcaaagaaattaaagattcttatggaa
caaagagtgggttgtgcgtctcagcaaagatccacacaggagaaagccaagaaagagcaa
gagaatagactgaagtttgtgaaggaacagcttgaaatcagtacacgtgagataaaatgc
ctgatcaaagagatcacttctaaagttgaggatcaggtgactgaggctatgacagaagag
attgtgaaatgttcagttcttggtagtcaacagtccacacttttttcaatctatttgtca
taa

DBGET integrated database retrieval system