KEGG   Pocillopora damicornis (lace coral): 113669665
Entry
113669665         CDS       T05773                                 

Definition
(RefSeq) BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
  KO
K15464  BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04068  FoxO signaling pathway
pdam04137  Mitophagy - animal
pdam04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113669665
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113669665
   04137 Mitophagy - animal
    113669665
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113669665
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdam02000]
    113669665
Membrane trafficking [BR:pdam04131]
 Autophagy
  Mitophagy
   Cargo receptors
    113669665
Transporters [BR:pdam02000]
 Other transporters
  Pores ion channels [TC:1]
   113669665
SSDB
Motif
Pfam: BNIP3 FliN_N
Other DBs
NCBI-GeneID: 113669665
NCBI-ProteinID: XP_027041537
LinkDB
Position
Unknown
AA seq 177 aa
MANNVNGGSHSSTESLNGSWVKLDGSFRNGNGAQHSPVISEDGAMEDLLAEAVQEQLSKQ
SSSGEKSPSGSPREQCPQGNLRTGDPILPQEQNTDWIWEWSSRIEVQPQKEWKMQHPRCK
SKPRRAKLSIRGTKVMRSAELMNINFYVVVPAVLLSHLIAFGIGVYVGRRMVQVDAL
NT seq 534 nt   +upstreamnt  +downstreamnt
atggcaaataatgtcaatggtggcagtcatagctccactgagtctttgaatggctcttgg
gtaaagctcgatggctcgtttagaaatggcaatggagctcagcattctccagttatttcg
gaagatggggcgatggaagatcttcttgctgaagcggtacaggaacaattgtcgaaacaa
agctcaagtggcgaaaaaagcccgtctggttcaccaagggagcaatgtcctcaagggaac
ctacggacgggtgatccaatccttccacaagagcaaaacacagattggatttgggagtgg
tcaagcagaattgaagtgcaaccacagaaggaatggaagatgcaacatcccagatgtaaa
tcgaagccacgtagggcaaaattgagtatcagaggcactaaagtcatgagaagcgcagaa
ttaatgaacattaatttctatgttgttgtacctgctgttttattatctcatctgattgca
tttggaatcggagtttatgtgggacggcgtatggttcaagtagatgccttatga

DBGET integrated database retrieval system