KEGG   Pocillopora damicornis (lace coral): 113670397
Entry
113670397         CDS       T05773                                 

Definition
(RefSeq) dnaJ homolog subfamily A member 1-like
  KO
K09502  DnaJ homolog subfamily A member 1
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113670397
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pdam03110]
    113670397
   04131 Membrane trafficking [BR:pdam04131]
    113670397
Chaperones and folding catalysts [BR:pdam03110]
 Heat shock proteins
  HSP40 / DNAJ
   113670397
Membrane trafficking [BR:pdam04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Co-chaperones
    113670397
SSDB
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP HypA
Other DBs
NCBI-GeneID: 113670397
NCBI-ProteinID: XP_027042338
LinkDB
Position
Unknown
AA seq 403 aa
MVKETTLYETLGVDPSATPSEIKKAYRKLALKYHPDKNPDAGDKFKQISHAYEVLSDEKK
RSIYDEGGEEALNGGPDIGGFHSPMDIFDMFFGTGHGHSRARQERKGKDMIHQLKVSLED
MYNGSTRQLALQKNVICSKCEGRGGKKGSVVSCNTCHGSGTRIRINQIALGMVQQIQTQC
RDCGGTGERIAEKDRCKNCQGKKTIKERKILEVHIDKGMKDGQKITFSSEGDQEPGIEPG
DIIIILDEKPHPVFRRDDMDLHMKMEIELVEALCGFQKTIEMLDKRQLLVTSHPTEIIKP
GEVKCVRDEGMPKFKSPYERGFLIITFSINFPPDGFLSAGEIPKLEQLLPPRDESIVPED
AEEVDLVKIDPQEQARSRMHHGGFHDDDEDYGPPRGGVQCQSQ
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggtcaaggagacgacactttacgaaactcttggcgtagatccgtctgctacccctagt
gaaattaagaaagcttatcgtaaactcgccttgaagtatcatccggataaaaatccagat
gccggcgacaaatttaagcagatttcccatgcctatgaagtattgtccgatgaaaagaaa
agaagcatttatgatgaaggaggagaagaagctcttaatggtggtccggacatcggtggg
ttccattccccaatggatatttttgacatgttctttggcacagggcatggacattccaga
gcacgtcaagaacgtaaaggaaaggatatgatacaccagctcaaggtgtccttggaagac
atgtacaatggttctacaagacaacttgctttgcaaaaaaatgtcatctgtagcaagtgc
gagggaagaggaggaaagaagggttcagttgtaagttgtaatacttgtcatggcagtggg
accaggatcaggatcaatcaaattgcactcgggatggttcagcaaattcaaacacaatgt
agggactgcggtggaacaggagagagaatagcagaaaaggatcgttgcaagaactgtcag
ggtaaaaagacaatcaaagaacgtaaaatcctggaggtgcatatcgacaaaggaatgaaa
gatggtcaaaagatcacattttcctcagagggagaccaggaacctggtattgaaccaggt
gacatcattatcattcttgatgaaaagcctcatccagttttccggcgagatgacatggac
ctgcatatgaaaatggaaatcgagctggttgaggcactctgtggctttcagaaaacgata
gaaatgttggataagaggcaactgctcgttacgtctcatcctacagagataataaaacct
ggcgaagtgaaatgtgttcgagatgaaggaatgccaaaattcaagagcccatacgagaga
ggatttctcatcataactttttcgataaacttccctccggatggatttctttctgctggt
gaaatccctaaactagagcagctgctacctcccagagacgaaagtattgttcctgaggat
gcagaagaagtcgaccttgtaaaaatcgatcctcaggagcaagcaagaagtcgtatgcac
catgggggctttcatgacgatgatgaagactatggcccaccaagaggaggggtgcagtgt
cagtcacagtaa

KEGG   Pocillopora damicornis (lace coral): 113673952
Entry
113673952         CDS       T05773                                 

Definition
(RefSeq) dnaJ homolog subfamily A member 2-like
  KO
K09503  DnaJ homolog subfamily A member 2
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113673952
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pdam03110]
    113673952
   03029 Mitochondrial biogenesis [BR:pdam03029]
    113673952
Chaperones and folding catalysts [BR:pdam03110]
 Heat shock proteins
  HSP40 / DNAJ
   113673952
Mitochondrial biogenesis [BR:pdam03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    113673952
SSDB
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP HypA
Other DBs
NCBI-GeneID: 113673952
NCBI-ProteinID: XP_027046228
LinkDB
Position
Unknown
AA seq 403 aa
MADTRLYEILGVSPSASDVEIKKAYRKLAKEYHPDKNPDAGDRFKEISFAHEVLSNPEKR
ELYDKYGEKGLREGAGMGGGMDDLLSHIFGGFGGGMFGGGGLRQRRRRGEDLFHPLKVTL
EDLYNGKSTKLQLSKNVICAVCKGVGGKAGAVRTCQGCKGRGIKVTIRQIGPGMVQQMQS
TCNECSGEGEVLNPKDRCKKCQGKKVVKESKILEVHVDRGMNDSQKITFRGEGDQEPGVE
PGDVILVLQQKDHELFTRQGDDLFMTKKIHLAEALCGFHMVIKHLDKRNLVVKYPAGQVI
EPGCIRGVVGEGMPAYRRPYDRGNLYVKFEIEFPPNNFIPGDKISLLESLLPSRPKQPSP
AEDAEEVDLMELDPRYSQKRREAYEDGSDDEAGHGPRVQCAHQ
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggcggacacgcggctctatgaaattctcggtgtttcgccgagtgcgagcgatgtggag
ataaaaaaggcttacaggaagctcgcgaaagagtatcaccccgacaaaaaccctgacgca
ggcgatagatttaaggaaataagcttcgctcacgaggtactttcgaaccctgagaaacgc
gaactttatgacaaatatggagagaagggattacgcgaaggcgctggtatgggtgggggt
atggacgatcttttgtcgcatattttcggtggttttggcggtggaatgttcggtggtgga
ggactcagacaaagaagaaggcgaggagaagatctcttccatcctctaaaggttacatta
gaagatctttacaatggaaagtcaaccaaattacaactcagtaagaatgtgatctgtgca
gtatgtaagggggttggtggaaaagctggagctgtgcggacatgtcagggatgtaaaggg
aggggaataaaagtgactattcgccaaattggtcctggaatggttcagcagatgcagtct
acctgtaatgaatgcagtggggaaggtgaagtactcaatccaaaggacaggtgtaaaaaa
tgccaggggaaaaaagttgttaaagaaagcaagatattagaggttcatgtagacaggggt
atgaatgacagtcaaaaaataacatttagaggagagggagaccaggagcctggtgttgaa
cccggtgatgttattctggtactacaacagaaagatcatgaattgtttacacgtcagggt
gatgatttgtttatgaccaagaaaattcatctggcagaagctctgtgtggcttccatatg
gtgatcaaacacttggataaaagaaatttagttgtaaaataccctgctggacaggttatt
gaaccaggttgcataagaggtgtggttggagagggtatgccagcgtacagaagaccctat
gacaggggaaatctctatgttaaatttgaaattgaatttcctccaaacaatttcatcccg
ggtgacaaaatttctttactagaatcattacttcctagtcggcctaaacaaccatcacca
gctgaggatgcggaagaagtggaccttatggaacttgatccaagatacagtcaaaaaagg
agagaagcatatgaggatggcagtgatgatgaagcaggccatggacctcgtgtgcagtgt
gcacatcagtaa

KEGG   Pocillopora damicornis (lace coral): 113675784
Entry
113675784         CDS       T05773                                 

Definition
(RefSeq) dnaJ homolog subfamily B member 5-like
  KO
K09507  DnaJ homolog subfamily B member 1
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113675784
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pdam03110]
    113675784
Chaperones and folding catalysts [BR:pdam03110]
 Heat shock proteins
  HSP40 / DNAJ
   113675784
SSDB
Motif
Pfam: DnaJ_C DnaJ
Other DBs
NCBI-GeneID: 113675784
NCBI-ProteinID: XP_027048192
LinkDB
Position
Unknown
AA seq 331 aa
MGRDFYSVLGVPKNASVEDIKKAYKRQALLFHPDKNKNSGAEETFKKISEAYSVLTDPDK
RRIFDSYGEEGLKNECGGFGFPPFTDPAHIFRDVFGNDPDFQFSDFMDGDFNPNFSRLFS
TSRNSSTFGGFKHFCDEDFDFPCPEPFKKQPVRDPPIETNLQVSLEELDTGCTKQLKLTR
QALSPSGQASPEEKILTIEVKPGWKAGTKVTFEQHGDQKPGVIPADIIFVIGDKPHQYFK
RDAENNLLYTAKVDLRDALCGCVLQIPTIKGRFLAVQLNEVIQPGTQKRIPNEGLPLPKF
PGKRGDMIVTFDVEIPTNLTMEQRQHIAGCF
NT seq 996 nt   +upstreamnt  +downstreamnt
atggggagagatttttattccgttcttggggttcccaagaatgcctcggtggaagacatc
aagaaggcttataaaaggcaagctcttctgtttcatccagacaagaataaaaactctgga
gcagaagaaacgttcaaaaaaatatctgaggcctactcagtgctaacagatccggacaaa
agaagaatattcgatagctatggcgaagaagggctcaagaacgaatgtggcgggtttggt
ttccctccattcacagaccccgcgcacatcttccgcgacgtttttggcaatgatcctgat
tttcagttctcagacttcatggatggagattttaaccccaatttctctcgcttgttttct
acctcacggaactcatcaacctttggaggctttaaacatttttgtgatgaagattttgac
ttcccctgtcctgagccatttaagaaacaacctgttcgagatcctcctattgagaccaac
ctacaagtttcccttgaagaacttgacactggatgcacaaaacaacttaagctaaccaga
caagccttatctcccagtggacaggcttctcctgaagaaaaaattctgacaattgaagtc
aaacctggctggaaggcaggaacaaaagtaacctttgaacaacatggagatcagaaacca
ggagtaattccagcagacattatttttgttataggggacaagccccaccaatactttaaa
agagatgctgaaaacaacctcctctatacagcaaaagtggatctgcgtgatgctctttgt
ggatgtgtacttcagattccaactattaagggaagattcttagcagtgcagctaaatgag
gttatacaaccaggaacacagaaaagaattccaaatgaaggtctccctctgccgaaattt
ccaggaaaaaggggggatatgatagtgacatttgacgtagagatccctacaaatttgaca
atggaacagagacagcatattgctggctgtttttag

KEGG   Pocillopora damicornis (lace coral): 113683169
Entry
113683169         CDS       T05773                                 

Definition
(RefSeq) dnaJ homolog subfamily C member 5-like isoform X1
  KO
K09525  DnaJ homolog subfamily C member 5
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113683169
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pdam03110]
    113683169
Chaperones and folding catalysts [BR:pdam03110]
 Heat shock proteins
  HSP40 / DNAJ
   113683169
SSDB
Motif
Pfam: DnaJ
Other DBs
NCBI-GeneID: 113683169
NCBI-ProteinID: XP_027056181
LinkDB
Position
Unknown
AA seq 210 aa
MAPHSGVNGESKGEGQDHALAKDGASLYDVLGVDKSATQEEIKKAYRKMALKHHPDKNPN
NPEATEKFKEVNHAHSILADPSKREIYDKYGSMGLYIAEQFGEENVKLYFRLNSGWCKAL
FMFCGIITCCYFCCCCFFCCNFCCGKCKPVPDEQWEDFEFDDVKDEEDPITKQPGSNGND
TSSEQPPKSPGVDSAASNSTANSAIPMPSS
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcaccgcattctggtgtcaatggcgaaagtaaaggagaaggacaggaccatgctctt
gcaaaagacggggcttcactctatgatgttcttggagttgacaaaagtgcaacacaagag
gaaattaagaaagcgtataggaagatggcactgaagcaccatcctgataaaaatcctaat
aatcctgaagctacagaaaaatttaaggaagtcaatcacgcacatagtatattagctgat
cccagtaaaagggaaatttatgacaagtatggctctatgggtctctatatagctgaacaa
tttggagaagagaatgtcaaattgtacttcaggctcaacagtggctggtgtaaagcgctg
ttcatgttctgcggaatcataacttgctgttacttctgctgttgctgcttcttctgttgt
aatttctgttgcggaaagtgcaagccagttccagacgagcagtgggaggatttcgaattt
gacgacgttaaagatgaggaggatccgataacgaagcagcccggtagtaacggaaatgac
acaagcagcgagcaaccccccaaatcacctggtgttgacagcgcggccagcaacagtaca
gcgaattccgctatccctatgccctcgtcgtga

DBGET integrated database retrieval system