KEGG   Pocillopora damicornis (lace coral): 113673552
Entry
113673552         CDS       T05773                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113673552
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdam03019]
    113673552
   04121 Ubiquitin system [BR:pdam04121]
    113673552
Enzymes [BR:pdam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     113673552
Messenger RNA biogenesis [BR:pdam03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     113673552
Ubiquitin system [BR:pdam04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    113673552
SSDB
Motif
Pfam: DUF641 DUF1664 MCPsignal HrpB7 FliJ TRAF_BIRC3_bd DegS
Other DBs
NCBI-GeneID: 113673552
NCBI-ProteinID: XP_027045759
LinkDB
Position
Unknown
AA seq 329 aa
MADISEEGYRLRKVQSKLANNCQNDSAWLVQQKMKQSEVKKHNELSAILHLNLLLTSVLR
LEEQVKSQLSMGGAWGGGTSDQWMRRSEMTIANAISSIDTVVREQTDLRQKLEDNSMRLV
SMEKRVSTHRDRFPQSATFSSLQPLPISDEISRRLTNAENGTNNIEFLVNETRRELNEVR
QEVSSVKRQLDGAVDSIRRLERRMESVEHNLALRNVVLSDIEEHVQQQQVYTYNGILLWK
ISDFARKKNDAITGREVSIYSPCFHTSQHGYKMRARLYLNGDGMGKGTHLSLFFIVMRGD
YDALLRWPFRQKVTFMLLDQDNVEHVVDA
NT seq 987 nt   +upstreamnt  +downstreamnt
atggcagacatttctgaggagggataccgtttgcgtaaggttcagtcaaaactggcaaac
aattgtcagaacgatagcgcgtggttggtacaacagaaaatgaagcaatccgaggtcaag
aaacataatgagctgagtgcaattttgcacttaaatctactcttgacgagtgttcttcgg
ctagaagagcaagtgaaaagtcagctctctatgggtggtgcatggggtggtggcacctcc
gatcagtggatgagacgatcggagatgaccatcgctaacgccatatcaagcatcgacaca
gtggtacgcgagcaaaccgacttacgacagaagctagaagataattctatgagacttgtg
tcgatggaaaaaagagtttcaacccatagagaccggttcccacaatcggcaactttctct
tcgttacaaccactccccatttcggacgagatttcacgacgtctcacaaatgccgaaaat
ggcaccaataatatcgagttcttggtaaacgaaacaaggcgtgagttgaacgaagtcaga
caagaagtatcgtctgttaaacgccaattggatggcgcggtggacagtattagacgactc
gaacgaagaatggagtctgtagaacataatttggcgctcagaaatgttgttttgtctgat
atcgaagaacatgttcaacagcagcaagtttatacatataatgggatcttactctggaaa
atatcggattttgcacgtaagaaaaatgatgccataactgggcgagaggtctcaatatat
agcccgtgctttcataccagtcagcatggttacaaaatgcgcgcgcgactttacttaaac
ggtgatggaatgggtaaaggaacccatctgtcgctgttcttcattgtcatgcgtggagac
tacgatgcattactccgctggccatttagacagaaggtgaccttcatgctgttggatcaa
gataacgtagagcacgtggttgatgct

KEGG   Pocillopora damicornis (lace coral): 113686733
Entry
113686733         CDS       T05773                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113686733
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdam03019]
    113686733
   04121 Ubiquitin system [BR:pdam04121]
    113686733
Enzymes [BR:pdam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     113686733
Messenger RNA biogenesis [BR:pdam03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     113686733
Ubiquitin system [BR:pdam04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    113686733
SSDB
Motif
Pfam: zf-TRAF Crescentin zf-C3HC4_3 zf-C3HC4_4 zf-C3HC4_2 zf-C3HC4 CENP-Q Sina zf-RING_5 zf-RING_UBOX Csm1_N DUF641 Glyco_hydro_2_C DHR10 RasGAP_C DUF2203
Other DBs
NCBI-GeneID: 113686733
NCBI-ProteinID: XP_027060193
LinkDB
Position
Unknown
AA seq 561 aa
MPGYTCNRICENGKSIDPKYLCLHCEKVLRDPVQTSCGHRYCKSCVESLLRLPSPRCVVD
GEEFGEIFEDKFAQREILSLPVQCENHCDGCEWSGELRQFEKHEAQCPYAKVQCVHPSCG
TLVQRDDLSRHLVEDCIFREQQCGYCSIKTTADKLEEHLEKECLEYPVDCLQCKTEKIPR
KQLSSHLDPVNGDCEAVKAPCPFHKVGCKHKGEMKRKERRRHQDKQVSDHLTLLFLFVDQ
LSNLFHSKLGDVDAGVISKMDAILKTLQNKIDVIIGENSDLTSMVQGHGTRISNLEQNIK
RYLMDDVVADSAPLNSSAHRSSQAEIVNILQKLDNQDAKAANHEVLLVEFNSEMQNRNRE
IKRLEAQLKTANDEIRKLQRRTEYLEHTLGARNIAIAELEDYVRQEQFSSYNGVLLWKIT
DFTRKRNEARSGQHVSTYSPCFYTSRHGYKMCARIYLNGDGIGKGTHFSIFFVVMRGEYD
AILRWPFRQKVTFMLLDQDNVEHVVDAFRPDPNSSSFQRPKRDMNIASGCPTFCAMTQLN
NHAYVKDDTMFIKVIVDIGNL
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgcctggttacacatgcaatcgtatttgcgagaatggaaagtccattgaccccaaatac
ctctgcctccactgtgaaaaggtattgagggatccagttcagacgagctgcggtcatcgc
tactgcaagtcatgtgtggagtcattgttaaggttgccctctccaaggtgtgtggtggat
ggggaagagttcggagagatatttgaagacaagtttgcgcagcgtgaaatcctgtcgtta
ccagtccagtgtgaaaatcactgcgacggctgcgagtggagtggggaactgcggcagttc
gagaaacacgaggcccagtgtccctatgccaaggtccaatgtgtgcatcccagttgcgga
accctggttcagagagatgacttatctcggcaccttgtggaggattgtatcttcagagag
cagcagtgtgggtattgctccataaagactacagctgataagcttgaggaacatcttgaa
aaggagtgcctagaataccctgtggattgtttgcagtgtaaaactgaaaaaattccacga
aagcagctttcgagtcaccttgatcctgttaatggagactgcgaagctgttaaagccccg
tgtccttttcataaagtgggatgcaaacataaaggggaaatgaaaaggaaagaacgtaga
agacaccaggataaacaagtatctgatcatttgacactcctttttctgtttgtggaccaa
ttgtctaacttgtttcattccaaacttggcgatgttgacgccggagtcatttctaaaatg
gatgcaatccttaaaactttacaaaataagatagatgtcataatcggtgaaaattctgac
ctgacatcaatggttcaaggacatggcactcgcataagtaatcttgaacaaaatatcaag
cgttatttaatggatgacgtggtagccgacagtgctcccttaaattcatcagcgcatcgc
tcttcgcaagctgaaattgtgaatattctacaaaagctggacaatcaggatgctaaggca
gccaatcatgaagttcttttggttgaatttaactcggaaatgcaaaataggaatagagaa
ataaaaagactggaggctcagcttaaaactgctaacgatgagataagaaaacttcaacga
cggacggagtatctagaacatactctaggtgctaggaacattgctatagctgagctagaa
gattacgttaggcaagagcaattctcaagctacaatggtgtgcttttatggaaaattact
gacttcacccgaaaacgaaatgaggcgagatccggccaacacgtatctacttatagtccc
tgtttctatactagtcgtcacggttataagatgtgcgcgcgcatctatctaaacggtgat
ggtatcggaaagggaacacatttttcaatattctttgttgttatgcgcggtgagtatgac
gcaatactccgctggccatttagacaaaaggtcacctttatgttattagatcaggataac
gtagaacacgtagttgacgccttcagacctgatccgaatagctcctcattccagagacca
aaaagggatatgaacatagccagtgggtgcccgaccttctgtgctatgacacagttaaat
aaccacgcttatgtaaaggacgataccatgtttatcaaagttattgttgatattgggaac
ttataa

DBGET integrated database retrieval system