KEGG   Pocillopora damicornis (lace coral): 113674918
Entry
113674918         CDS       T05773                                 

Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04068  FoxO signaling pathway
pdam04136  Autophagy - other
pdam04137  Mitophagy - animal
pdam04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113674918
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113674918
   04136 Autophagy - other
    113674918
   04137 Mitophagy - animal
    113674918
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113674918
   04121 Ubiquitin system [BR:pdam04121]
    113674918
   03029 Mitochondrial biogenesis [BR:pdam03029]
    113674918
Membrane trafficking [BR:pdam04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    113674918
Ubiquitin system [BR:pdam04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   113674918
Mitochondrial biogenesis [BR:pdam03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    113674918
SSDB
Motif
Pfam: ATG8 APG12
Other DBs
NCBI-GeneID: 113674918
NCBI-ProteinID: XP_027047216
LinkDB
Position
Unknown
AA seq 102 aa
EGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDAL
FFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGAQ
NT seq 309 nt   +upstreamnt  +downstreamnt
gaaggagagaaaattcggaagaagtacccggacagagttccggttattgttgagaaagca
ccaaaagcaaggataggagacttggataagaagaaatacctggttccctcagatttgaca
gttggacagttttacttccttattcggaagcgaattcatctcagacctgaagatgccttg
ttcttttttgtgaacaatgtcatcccccccacaagtgcaacgatgggtcagctttaccaa
gaacatcatgaagaagacttcttcctctacatagcatacagtgacgagagtgtctatgga
gctcagtag

KEGG   Pocillopora damicornis (lace coral): 113678041
Entry
113678041         CDS       T05773                                 

Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein-like 2
  KO
K08341  GABA(A) receptor-associated protein
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04068  FoxO signaling pathway
pdam04136  Autophagy - other
pdam04137  Mitophagy - animal
pdam04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113678041
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113678041
   04136 Autophagy - other
    113678041
   04137 Mitophagy - animal
    113678041
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113678041
   04121 Ubiquitin system [BR:pdam04121]
    113678041
   03029 Mitochondrial biogenesis [BR:pdam03029]
    113678041
Membrane trafficking [BR:pdam04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    113678041
Ubiquitin system [BR:pdam04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   113678041
Mitochondrial biogenesis [BR:pdam03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    113678041
SSDB
Motif
Pfam: ATG8 APG12 ubiquitin
Other DBs
NCBI-GeneID: 113678041
NCBI-ProteinID: XP_027050714
LinkDB
Position
Unknown
AA seq 117 aa
MKWSFKEEHSLESRCHESAKIRAKYPDRIPVVVEKAPKTSIQDIDKRKFLVPSDLTVAQF
MYIIRKRIQLPPEKAMFLFVNKVLPQTSSTMGSIYEEHKDEDGFLYIAYSGENTFGM
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagtggagttttaaagaggaacattccttagagtcaagatgccacgaatctgcaaag
ataagggcgaagtatcctgaccgaattcccgtcgttgttgagaaagcacctaaaaccagc
attcaagatatcgataaaaggaaatttcttgttccttcggatctgacagtggcgcagttc
atgtacatcatccggaagagaattcagcttcctccagaaaaggcgatgtttctttttgtc
aacaaagttcttccacagacaagttcaaccatgggttctatctacgaagaacacaaagat
gaagatggcttcctgtacattgcctatagtggggaaaacacttttggaatgtaa

DBGET integrated database retrieval system