KEGG   Pocillopora damicornis (lace coral): 113675898
Entry
113675898         CDS       T05773                                 

Definition
(RefSeq) autophagy-related protein 9A-like
  KO
K17907  autophagy-related protein 9
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04136  Autophagy - other
pdam04137  Mitophagy - animal
pdam04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113675898
   04136 Autophagy - other
    113675898
   04137 Mitophagy - animal
    113675898
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113675898
   03029 Mitochondrial biogenesis [BR:pdam03029]
    113675898
Membrane trafficking [BR:pdam04131]
 Autophagy
  Autophagosome formation proteins
   ATG9 transmembrane protein
    113675898
Mitochondrial biogenesis [BR:pdam03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    113675898
SSDB
Motif
Pfam: ATG9
Other DBs
NCBI-GeneID: 113675898
NCBI-ProteinID: XP_027048304
LinkDB
Position
Unknown
AA seq 696 aa
MAGFRTQYTRLNSNSDDPEEDLPPQGFDIGTRGVEEVEKGRWNHIENLDEFFIRIYEYHR
NNGFVCILLKEVFELIQFVFVVLFTSFLVLCVDYNTLFNHKQPSFSNVLYFHKIEHMEPA
IMACLVIAFIFWLIRVARIVIHFFKLLEIRAFYKDALRISESELTNLQWQDVQKRLIEVQ
KVHQMCVHKEELSELDIHHRILRWKNYLLAMQNKSVISCTYNFPFVGERAFLTEGMKYNL
KMILFWGPGSPFQNNWKLRDEFRNPANRFPLASRLARRIFWIGIANFVLSPFIFIWVILY
SFFTYAEMVKREPDTFGARRWSSYGKLFFRHFNELDHEIQTRLSKAYEPASKYMNLFVSP
FMAIIAKNMAFFAGAIFAILTIFTVLDKDVLLAEHVLTVIATLGLLIRGCYVFIPDENTV
WDPEQLLKQIVSHTHYIPDSWRGKAHTSEVRQKFSQVFQYKAEYVLQELLSPIVTPFLLC
FHLRYKSLDIVDFFRNFTVDVVGVGDVCSFAQMDVKRHGNPEWLTQGLTEATQYEQAEHG
KTELSLVQFSIRNPTWKPSEQGTQFISTIRENAVQEGLNLSCSGVMSDANSLPDLRSGSF
QALPYMNSMTLSDPSLIPLGSAAVTPKQQAQAREMLMNSSMMYMHQLRDRQADQPPGGAA
RVASLTSADRQQPGTSGQHFAEDSKTEQIRDDAHMV
NT seq 2091 nt   +upstreamnt  +downstreamnt
atggcaggttttcggacgcagtacactcgattaaattcaaattcagatgatcctgaagag
gacttacctccacaaggtttcgatatcggcacccggggagttgaggaagtcgagaaaggg
cgttggaatcacattgagaatcttgatgaattcttcataaggatatatgaatatcacagg
aacaatggatttgtttgtattctcctgaaggaagtctttgaattaattcaatttgtgttt
gtggttttatttacctctttcttggtgctttgtgtggattataacaccttgtttaatcac
aaacaaccttccttttcaaatgtgctgtatttccacaaaatagaacacatggagcctgca
ataatggcttgtctggtcattgcttttattttttggttgatacgtgtggctagaattgta
attcatttctttaagcttctggaaatccgagcattttataaggatgcacttagaatatca
gagagtgaactaacaaacctacagtggcaagatgttcagaaacgattgatagaagtgcaa
aaagttcatcaaatgtgtgttcataaggaggaattgtcagaacttgatatccatcaccga
attctgagatggaaaaactacctgctagcaatgcaaaacaagtccgttatttcttgtaca
tacaactttccatttgttggggaaagggcctttttgacagagggtatgaagtacaatctg
aaaatgattttattctggggaccaggaagtccttttcaaaacaactggaagctaagagat
gaattcaggaacccagcaaacaggtttcccctggcaagtcggttggcaagacgtattttc
tggattggaatagcaaactttgtactttcccctttcatctttatctgggttattttatat
tccttctttacttatgctgagatggtgaaaagggaacctgatacgtttggtgcccgcaga
tggtcatcttacggcaagctgttttttcgacattttaatgaattggaccacgagatacag
acgaggttaagtaaggcttacgaaccagcgtccaagtatatgaatcttttcgtgtcacct
tttatggccatcatagccaagaacatggcatttttcgctggcgcgatttttgccatattg
accatatttactgtcctggacaaggatgttcttttggctgaacatgtgctgactgttata
gcaacactaggattactgataagaggatgttacgtttttatccctgacgagaacactgtg
tgggaccctgaacaactgttaaaacaaattgtgtctcatactcattatatacctgactcg
tggagaggcaaggcgcataccagcgaggtgaggcaaaagttttcccaggtgttccagtat
aaagcggaatatgtacttcaagagctgttaagccctattgttacaccgttccttctgtgt
ttccacttgcggtacaagtctctggatattgtggatttctttaggaattttactgttgat
gttgttggtgtcggagatgtttgctcgtttgctcaaatggatgttaagagacatggaaac
ccagagtggcttacccagggattaacggaagcaacacagtatgaacaggccgaacatggc
aaaacggaactgtcgcttgtgcaattttcaataaggaaccctacatggaagccatcagag
caaggcactcagttcattagcaccattcgggaaaacgcggtccaagaaggtctcaacctg
agctgcagcggtgtaatgtcggacgccaactcacttccagatttaagatcaggcagtttt
caagcgctaccatatatgaactccatgaccctcagcgatccgtccctcattcctctaggg
agtgctgctgtcacaccaaaacagcaggcccaagcaagagaaatgctcatgaactctagc
atgatgtacatgcatcagctgcgagatcgtcaagctgatcaaccgcccggcggggcagct
cgtgttgcctccttgacgtcagcagacagacaacaaccggggacatctgggcagcatttt
gcagaagacagcaaaactgaacaaattagagacgatgcccacatggtgtga

DBGET integrated database retrieval system