KEGG   Pocillopora damicornis (lace coral): 113677819
Entry
113677819         CDS       T05773                                 

Definition
(RefSeq) ubiquitin-conjugating enzyme E2-17 kDa
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04120  Ubiquitin mediated proteolysis
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113677819
   04120 Ubiquitin mediated proteolysis
    113677819
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pdam04121]
    113677819
Enzymes [BR:pdam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     113677819
Ubiquitin system [BR:pdam04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   113677819
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 113677819
NCBI-ProteinID: XP_027050460
LinkDB
Position
Unknown
AA seq 147 aa
MALKRINKELQDLGRDPPSQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDY
PFKPPKVSFTTKIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLTDPNPDDPLV
PEIARIYKTNKPKYNETAKEWTRKFAQ
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcactaaagaggatcaacaaagaactgcaagatcttggacgtgatccaccatcacag
tgctctgctgggccggttggagatgacttgtttcattggcaagcgactataatgggtccg
cctgatagcccataccaaggtggagtgtttttccttacaatacatttcccaacagattat
ccttttaaacctccaaaggtatcatttactacaaaaatatatcatcctaacataaacagt
aatggcagtatttgtcttgatatcttacgatcccagtggagtccagcactaaccatttct
aaagtacttctgtcaatttgttctttgcttactgatccaaatcctgatgatcccttggtg
ccagaaatagcacgtatctataaaacaaacaaaccaaaatataatgaaacagcaaaagaa
tggacaaggaagtttgcccaatga

KEGG   Pocillopora damicornis (lace coral): 113677823
Entry
113677823         CDS       T05773                                 

Definition
(RefSeq) ubiquitin-conjugating enzyme E2-17 kDa-like
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04120  Ubiquitin mediated proteolysis
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113677823
   04120 Ubiquitin mediated proteolysis
    113677823
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pdam04121]
    113677823
Enzymes [BR:pdam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     113677823
Ubiquitin system [BR:pdam04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   113677823
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 113677823
NCBI-ProteinID: XP_027050464
LinkDB
Position
Unknown
AA seq 147 aa
MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDY
PFKPPKVSFTTKIYHPNINSNGNICLDILRSQWSPALTISKVLLSICSLLTDPNPDDPLV
PDIARLYKSDKGKYETEAKEWTRKYAM
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcgttaaaaaggataaacaaagaattgcaggatttaggacgtgacccgccagcacaa
tgttccgcaggaccagtcggagatgatttatttcactggcaggcgacaataatgggaccg
cctgatagtccataccaaggtggagtgttcttccttacgatacattttccaacagattat
cccttcaaaccaccaaaggtatcatttacaacaaaaatatatcaccctaacataaacagc
aatggtaatatttgtcttgatatattacgatcgcagtggagtccagcactaacaatttct
aaggttcttttgtcaatatgttcattgcttacagatccaaatccagatgatccattagtg
ccagatatagcacgtctatacaaatcagacaagggtaaatatgaaactgaagctaaggag
tggactcggaagtacgccatgtga

DBGET integrated database retrieval system