KEGG   Pocillopora damicornis (lace coral): 113678345
Entry
113678345         CDS       T05773                                 

Definition
(RefSeq) glucosidase 2 subunit beta-like isoform X1
  KO
K08288  protein kinase C substrate 80K-H
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113678345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:pdam04091]
    113678345
Lectins [BR:pdam04091]
 P-type lectins
  113678345
SSDB
Motif
Pfam: PRKCSH-like PRKCSH_1 PRKCSH EF-hand_5 EF-hand_6 ATG14
Other DBs
NCBI-GeneID: 113678345
NCBI-ProteinID: XP_027051029
LinkDB
Position
Unknown
AA seq 556 aa
MAAFHGLSQMGKISLVIIAIFLFNLNIATASTIRGVALTRLAFYDPSRDFTCLDKSATVP
FNSVNDDFCDCVDGTDEPGTSACTNGKFHCTNAGFKPLNIPSSRVNDEICDCCDGSDEYD
GTVTCPNTCKELYRELFQKQREEAELAKQGLAIKQDYSQQGQGKKEERKQKLEELKKQLE
EKKAVVENLKAKKEEVEAVEKEAKDKHEKDWEETKAKIVAERDRASAESSFKALDTDEDG
RVTAQEVINTDLLDKKYGEEEAKELLGGYEESDFEGFFSALWSNFKEKFGDKQSQPPPAD
ESVTTEGEDKPTEASDTPESPPLPPPADENFDDEDLPDVPGEEDDDEDDEDDDRDEHVDE
IKEEAEKKIPEPNPEDSKDDDLKMPDYDEETKAKISAADDARKEFNAADTASNDAEREIS
DLERTLNLNLGQQEEFSPLQGQCFEYTDREYVYKLCPFDRASQQPKDGGSETSLGTWGEW
TGDSNKYSRMKYSGGQSCWNGPSRSAEVILRCGSANELVQVSEPSRCEYRMEFKTPAACQ
DIDLEGAHVHEHGGEL
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggcggcgttccatggcttatctcaaatgggaaaaatttctctagttataattgcgatt
tttctatttaacttgaatatagctacagcgtccactataagaggagtggcacttactagg
ttagcattttatgatccatccagggacttcacttgcttggataaatctgcaactgttcca
tttaatagtgtaaatgatgatttttgtgactgtgttgatggcactgatgaaccaggaaca
tcagcttgcactaatggaaaattccactgtacaaatgctgggtttaagcccttaaatatt
ccatcttccagagtcaatgatgaaatttgtgactgttgtgatggcagcgatgaatatgat
ggcaccgtaacctgtccaaatacttgcaaggaactttatagagaattgttccagaaacag
cgagaagaagctgaactggcaaagcaggggctggctattaaacaagactacagtcagcaa
ggtcagggaaaaaaagaagaaagaaagcaaaagcttgaagaattgaagaaacagctggag
gagaagaaagctgttgttgaaaatttgaaagccaaaaaagaggaggttgaagcagttgaa
aaggaagctaaggataaacatgagaaggactgggaagaaaccaaagcgaaaattgtggca
gaaagagacagggcatctgctgagtcttcattcaaagctctggatacagatgaggatgga
cgtgtgacagcacaagaggttattaatactgatcttctggataaaaaatatggtgaagaa
gaggccaaggagctgctaggaggatatgaggaatcagattttgaaggctttttctctgca
ttgtggagcaatttcaaagaaaaatttggtgacaagcagtcccagccaccacctgcagat
gaatcagttacaactgagggcgaagataaacccacggaagcaagtgatacacccgagtct
ccccctctgcctcctccagctgacgaaaattttgatgatgaagatcttccagacgttcct
ggtgaagaagatgatgacgaagacgacgaagatgatgatagagacgaacacgtggacgaa
atcaaagaggaggccgagaagaaaatacctgaaccaaacccagaagatagcaaagatgat
gatttgaagatgccggactatgacgaggaaacaaaagcaaaaatttctgctgctgatgat
gctagaaaggagtttaatgctgcagataccgcttcaaatgacgcagaaagagaaatcagt
gaccttgagcgaacgttgaatctgaaccttggccagcaagaagagttttcgccccttcag
ggacaatgttttgaatacaccgacagagagtatgtgtacaaactgtgtccatttgacaga
gcttcacagcagcccaaagatggaggctcagaaacctctctgggaacatggggtgaatgg
acaggtgactccaataagtacagtcgtatgaaatattcaggaggacagagctgttggaac
ggacctagcagatcagctgaggtaatccttcgttgtggctcagcaaacgagctggttcaa
gtatcagagcccagcagatgtgaataccgcatggaatttaaaactcctgcagcatgtcag
gatattgacctagagggcgcacatgtacatgaacatggcggggaactgtaa

KEGG   Pocillopora damicornis (lace coral): 113679869
Entry
113679869         CDS       T05773                                 

Definition
(RefSeq) neutral alpha-glucosidase AB-like
  KO
K05546  mannosyl-oligosaccharide alpha-1,3-glucosidase [EC:3.2.1.207]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00510  N-Glycan biosynthesis
pdam01100  Metabolic pathways
pdam04141  Protein processing in endoplasmic reticulum
Module
pdam_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    113679869
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113679869
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.207  mannosyl-oligosaccharide alpha-1,3-glucosidase
     113679869
SSDB
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Other DBs
NCBI-GeneID: 113679869
NCBI-ProteinID: XP_027052645
LinkDB
Position
Unknown
AA seq 967 aa
MATFYISRIVSLLLVWIIPEINAVDKGNFKKCEQSSFCKNNREIQPGESPYSVVKDSLVF
TDSSLDVNILNKKSNVLLGLKLQTLEKNTVRFRINERNPIRPRYEVKDVLIQEPKTISNQ
KLKQDDESVHIGFNNNSVVLTFEPFRLDFLVDNEVAVSVNSRGLMNFEHYREKQKIPVKV
EDDDGEGHPPGENEEEKSDEHPESKENAEKKEEEEERVEEENWEENFKEHHDSRPRGPCS
VGLDISFPGVEHVYGIPEHADTLALKTTVGSEPYRLYNLDVFEYELDSRMALYGSIPVMI
AHSVARTVGVFWMNAAETWVDISSSSARKSMLNSLMSFFKGSEEVPQVDTHWISESGIID
VFVMLGPKPHDLFQEYAAFTGTTALPPLFGIAYHQSRWNYNDEDDVKNVDKGFDDHDIPY
DVLWLDIEHTDGKKYMTWDKNKFPTPDQMQKNLASKGRKMVTIIDPHIKREGGYHIHEEA
TRLGYYVKNKDGGEYENWCWPGTSSWIDFLSPEIRKWWGSKFALSEYQGSTETLFTWNDM
NEPSVFHGPEITMHKDALHFGDWEHRDVHNIYGFYQHMATVQGQIDRSGGRERPFVLSRA
FFAGTQRNGPIWTGDNTADWGHLKASLPMILTLNLVGLPFSGADVGGFFKNPDPELLLRW
YQAAAFLPFFRAHAHLDTKRREPWLYDEQYKNLIRDAIRVRYSLLPYWYTLFYHASETGT
PIVRPLWVEYPEEKNTFAMEDEFLLGKDLLVKPVTTQGQNSIDVYLPGKGEYWYDLHDFK
IYRGESTIYVSTPLEKIPVFQRGGSIIATKQRIRRCSALMHKDPYTLTMALNPSAEAEGD
LYVDDGHTFDYKNGAYIYMKFSFRGGRMVAKNASKPIPLQPQTEESGILSSMWNFLRETP
NTQYTTAAWIERIVILGISNAPKGIFLTSDGGETRHLQFTHDPSTHTMTIKKPGVNIAKE
WTITMHA
NT seq 2904 nt   +upstreamnt  +downstreamnt
atggctactttttatatctcaaggattgtttcactccttctggtgtggataattccagaa
attaatgccgtggataagggaaactttaagaagtgtgagcaaagtagcttttgcaagaat
aatagagaaattcaaccaggagagtctccatattcagtagtcaaagattctctagtattt
acagattcctcccttgatgttaatatactaaataagaaatcaaatgtattactcggtcta
aagcttcaaacattagagaaaaatacagtaagatttagaattaatgaacggaacccaatt
agaccaagatatgaagtcaaagatgtcttgattcaagaaccaaagactataagtaaccaa
aaactcaaacaggatgatgagagtgtccacattggatttaataacaacagtgttgtttta
acatttgagcctttccgcctggattttttggttgataatgaagtggcagtatctgttaat
tcaagagggctgatgaattttgagcattatagagaaaaacagaaaattcctgtcaaggtt
gaagatgatgatggagaaggtcacccacctggagaaaatgaggaggaaaagtcagatgag
cacccagaatcgaaagaaaatgcagagaaaaaagaagaagaagaagaaagagtcgaagaa
gaaaactgggaagaaaactttaaagagcatcatgattctcgaccacgaggtccctgttct
gttggtttggacatctcattccctggtgttgaacatgtgtatggaatcccagaacatgca
gacaccctagctctcaagacaacagttggttcagagccataccgtttgtacaacttagat
gtgtttgagtatgagctggactccaggatggctctttatggcagtattcctgtcatgatt
gctcatagtgttgcacgcacagttggtgtgttctggatgaatgcagctgaaacgtgggtg
gacatcagttcatccagtgccagaaagtccatgttaaactcactgatgtcctttttcaag
ggaagtgaggaggtccctcaggtggacacccactggatttcagagagtggcatcattgat
gtgtttgtcatgttgggtccaaaacctcatgacctgttccaagagtatgctgcattcact
ggcacaactgccctgccaccactgtttggaattgcttatcatcaaagtcgatggaattac
aatgatgaagatgacgtcaaaaacgttgataagggttttgacgatcatgatattccctat
gatgttctgtggctggacattgaacatactgatggaaagaagtatatgacttgggacaag
aataaattcccaacgcctgaccagatgcagaaaaacttggcgtcaaaaggtcgaaagatg
gttactatcattgatccccacatcaaacgcgagggtggatatcacattcatgaggaagcg
acaagactgggttattatgtgaagaacaaagatggcggagaatacgagaactggtgttgg
ccaggaacttcatcgtggatcgatttcctcagtccggaaattcgcaagtggtggggcagt
aaatttgctctgagcgagtatcagggctccacagaaactctttttacctggaatgacatg
aatgagccctcggttttccatggaccggaaataaccatgcataaagacgcgcttcacttc
ggagactgggaacaccgcgatgtgcacaacatctacggcttctatcagcacatggcaaca
gtgcaaggacagatagaccgttcagggggaagggaaagaccgtttgtcctgtcgcgagct
ttttttgcaggaacccaaagaaacggtcccatttggacgggagacaacacggcggactgg
ggccacctaaaggcatctcttcccatgatcctcaccctaaacttggttgggctgccgttt
tccggagctgatgtcggtggcttctttaaaaatcctgacccagagctgttactcaggtgg
tatcaggcggctgccttcctgccattcttccgcgcacacgctcacttggacaccaaacgc
cgggagccttggctttacgatgagcagtataagaatctgatcagagatgccatccgtgtg
aggtactcactgctgccgtattggtacaccttgttctaccacgcctctgagaccggcacg
cccatagtcaggcctctgtgggtggagtatccagaggagaagaacacttttgccatggaa
gatgaatttttgctcggaaaagatcttcttgttaaaccagtcacgacccaaggacagaac
tcgatagatgtttaccttccaggaaaaggagagtactggtacgacttgcatgatttcaag
atttaccgaggggagagtacgatctacgtgtctacaccactcgagaagatcccagtgttc
cagcgtggaggaagcatcatcgcgaccaagcaacgaattcgccgatgtagtgcactcatg
cacaaggatccatatacgttaaccatggccttaaatcccagtgctgaagcagagggagat
ctttacgtggacgatggacacacctttgactacaagaatggcgcctacatttacatgaag
ttttcattccgtggcggacgaatggtggcgaagaatgcatccaaacccattcctcttcag
cctcagactgaagaatcagggattttatcgtcaatgtggaacttcctgcgggagacgccg
aacactcagtacactaccgctgcttggatagaacgcattgtcattcttggaataagtaac
gctcctaaaggaatcttccttacttctgatggtggagagactagacacctccagttcaca
catgatccctcgactcacacgatgacgatcaagaagcctggggttaatatagctaaagag
tggacaataactatgcacgcttaa

DBGET integrated database retrieval system